CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.010G229300.1
FamilyGH13
Protein PropertiesLength: 942 Molecular Weight: 104420 Isoelectric Point: 6.0631
ChromosomeChromosome/Scaffold: 10 Start: 21173048 End: 21184786
Descriptionlimit dextrinase
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133757793.3e-32
  AGVLHLKKLSNAGITHVHLLPTFQFAGVDDVKENWKCVDSTVLEKLPPDSTEQQAQITLIQDDDGYNWGYNPVLWGVPKGSYASNPSGSCRTIEFRKMVQ
  ALNHIGLRVVLDVVYNHLHGNGPFDENSVLDKIVPGYYLRRNTDGFIEHSTCVNNTASEHYMVERMIIDDMLNWAGNYKVDGFRFDLMGHIMKSTMVKAK
  DAVNRLTKERDGIDGSSVYIYGEGWDFGEVANNGRGINASQFNVGGTGIGSFNDRIRDAMLGGSPFGHPLQQGFVTGLMLQPNGHDHGGKDVEELMLSAA
  KDHIQVGMAGNLRDYVLTNSDGKEVKGMEVLTYGGAPVAYALHPAETINYVSAHDNETLFDVVSMKTPMEISVDERCRLNHLASSVIALSQGIPFFHSGD
  EMLRS
Full Sequence
Protein Sequence     Length: 942     Download
MMVLTSLSSS LLSSLSSLTG PPPSNSNVYF SSSLPSPRRR LNPEPNHHHR NRHLSLPLLS    60
RTSPTRSIHC SSSFSSMPLE VSTSPSQLQD SLLYSRAFWV TQSIIAWNAD VVRDGSCYLY    120
ASQTAALSVT DGEVEGHDFK IKLEEDSGGI PQNVIAKFPH VRDYKAFKVP STVDAKSLVK    180
CQLAVATFGS DGKCSYATGL QLSGVLDELF AYDGPLGAHY SEDAVSLYLW APTAQAVCAC    240
VYKNANSRDP VEVVQLKEVN GVWSVEGSKD WEGCYYVYEV SVYHPSTLHV EKCYANDPYA    300
RGLSPDSQRT LFVNLDSDTL KPEGWEKLAD EKPIILSFSD ISIYELHVRD FSANDHTVHP    360
DFQGGYLAFT LEDSAGVLHL KKLSNAGITH VHLLPTFQFA GVDDVKENWK CVDSTVLEKL    420
PPDSTEQQAQ ITLIQDDDGY NWGYNPVLWG VPKGSYASNP SGSCRTIEFR KMVQALNHIG    480
LRVVLDVVYN HLHGNGPFDE NSVLDKIVPG YYLRRNTDGF IEHSTCVNNT ASEHYMVERM    540
IIDDMLNWAG NYKVDGFRFD LMGHIMKSTM VKAKDAVNRL TKERDGIDGS SVYIYGEGWD    600
FGEVANNGRG INASQFNVGG TGIGSFNDRI RDAMLGGSPF GHPLQQGFVT GLMLQPNGHD    660
HGGKDVEELM LSAAKDHIQV GMAGNLRDYV LTNSDGKEVK GMEVLTYGGA PVAYALHPAE    720
TINYVSAHDN ETLFDVVSMK TPMEISVDER CRLNHLASSV IALSQGIPFF HSGDEMLRSK    780
SLDRDSYNSG DWFNRLDFTY NSNNWGVGLP PKQKNEKHWP LIRPRLADPS FKPQKNHILA    840
AINNFLDVLQ IRYSSPLFRL TTANAIQYYG LFYSYSFIVV IFNASPSEVS FASPVLRART    900
FQLHPIQAMS ADEVVKNSSY ETSTGCFTVP PRTTSVFVEY R* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1523PulA4.0e-89208937770+
TIGR02104pulA_typeI1.0e-133207894705+
cd11341AmyAc_Pullulanase_LD-like1.0e-164340804475+
PLN02877PLN02877071941901+
TIGR02103pullul_strch092941913+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI31395.102294116954unnamed protein product [Vitis vinifera]
RefSeqNP_196056.205194146963ATLDA (LIMIT DEXTRINASE); alpha-amylase/ limit dextrinase/ pullulanase [Arabidopsis thaliana]
RefSeqXP_002271820.108894123905PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315334.10779411893predicted protein [Populus trichocarpa]
RefSeqXP_002532780.10109412964pullulanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A0959416883A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2y5e_A0959416883A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2y4s_A0959416883A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A0979371791066A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A0979371791066A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1824EC-3.2.1.41pullulanase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1283442874076930
DV1354572645868490
DT7301142762405150
EL4526952623355960
EH7173812643085710
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00024.1
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Fragaria vescamrna23425.1-v1.0-hybrid
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.12Gorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2
Gorai.009G305300.3Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7
Gorai.009G305300.9Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Manihot esculentacassava4.1_004771m
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Phaseolus vulgarisPhvul.007G139400.1
Populus trichocarpaPotri.010G229300.4Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny