CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.011G006200.1
FamilyPL4
Protein PropertiesLength: 651 Molecular Weight: 73715.4 Isoelectric Point: 6.4043
ChromosomeChromosome/Scaffold: 11 Start: 509978 End: 513949
DescriptionRhamnogalacturonate lyase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL446120
  GNVRLINQGPYVMLDNDLVRLTILKPQGYLTGIKYGGMDNILDLQSNESNRGYWDMNWNLPGGKDRYQSVNGAEYSVIYNSNDKLEISFRSTYDPSNKGT
  KLPLSIDIRYILNSGVSGFHCYAIYERPAGSPAFDLVQTRMVFKLRRDKFHYMAISDEKQRVMPMPEDLLPGRGKQLIVPESVLLVNPINPDLKGEVDDK
  YQYSMDNKDGGVHGWIGSGPVIGFWVIFPSHEFRNGGPTKQNLTVHTGPTCLAMFHGTHYIGDDIVAQFQEGEAWRKVFGPFFVYLNSTSNVSDAYNLWI
  DAKKQRLLEEATWPYEFVSSPYYLNAKERGSATARLFVQERFVSESLIPAKNAYVGLSTARAQGAWQTESKDYQFWVQTDSNGNFTIKNVIPGVYGFHGW
  VPGFIGDFLDNALVTISEGSETQLGNLTYVPLRDGPTIWEIGFPDRTGIGFYVPDANPMYVNKLFVNSPEKFRQYGLWDRYTDVHPEYDQTFTIGISDPK
  KNWFFAHVDRRVADKYIPSTWTIKFLLNSIKNGIYKLRLAIASANRSDLQVYLNDMDKEHMVFQVMNLGAENAVCRHGIHGLYRLFSIDIPSSLLLNGDN
  SMFLVQARG
Full Sequence
Protein Sequence     Length: 651     Download
MGKGNVRLIN QGPYVMLDND LVRLTILKPQ GYLTGIKYGG MDNILDLQSN ESNRGYWDMN    60
WNLPGGKDRY QSVNGAEYSV IYNSNDKLEI SFRSTYDPSN KGTKLPLSID IRYILNSGVS    120
GFHCYAIYER PAGSPAFDLV QTRMVFKLRR DKFHYMAISD EKQRVMPMPE DLLPGRGKQL    180
IVPESVLLVN PINPDLKGEV DDKYQYSMDN KDGGVHGWIG SGPVIGFWVI FPSHEFRNGG    240
PTKQNLTVHT GPTCLAMFHG THYIGDDIVA QFQEGEAWRK VFGPFFVYLN STSNVSDAYN    300
LWIDAKKQRL LEEATWPYEF VSSPYYLNAK ERGSATARLF VQERFVSESL IPAKNAYVGL    360
STARAQGAWQ TESKDYQFWV QTDSNGNFTI KNVIPGVYGF HGWVPGFIGD FLDNALVTIS    420
EGSETQLGNL TYVPLRDGPT IWEIGFPDRT GIGFYVPDAN PMYVNKLFVN SPEKFRQYGL    480
WDRYTDVHPE YDQTFTIGIS DPKKNWFFAH VDRRVADKYI PSTWTIKFLL NSIKNGIYKL    540
RLAIASANRS DLQVYLNDMD KEHMVFQVMN LGAENAVCRH GIHGLYRLFS IDIPSSLLLN    600
GDNSMFLVQA RGGDALCGIL YDYLRLEAPA SPANSKQREE LESFQFDSHV *             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10316RGL4_M2.0e-25331430100+
cd10317RGL4_C2.0e-41442627190+
cd10320RGL4_N2.0e-696298299+
pfam06045Rhamnogal_lyase7.0e-7011200190+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23231.10166311617unnamed protein product [Vitis vinifera]
RefSeqXP_001769727.10156354626predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002285626.10176391625PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002317123.1016501650predicted protein [Populus trichocarpa]
RefSeqXP_002527353.1066366640lyase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE4732262881864730
DV9953492881864730
CO4737312781864630
GW8643723111444540
CO4749922822365170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00069.4Aquca_010_00069.3Aquca_010_00069.1Aquca_010_00069.2Aquca_010_00071.1
Aquca_056_00097.1Aquca_008_00160.5Aquca_008_00159.1Aquca_008_00160.2Aquca_008_00160.4
Aquca_008_00160.3Aquca_008_00160.1Aquca_005_00010.1Aquca_010_00071.2Aquca_023_00190.1
Aquca_010_00070.1Aquca_023_00190.2
Arabidopsis lyrata888241334271481121354330879190
353036315485912531
Arabidopsis thalianaAT1G09910.1AT1G09890.1AT2G22620.1AT4G24430.1AT1G09880.1
AT4G37950.1AT4G38030.1AT2G22620.2AT1G65210.1
Brachypodium distachyonBradi3g42610.1Bradi3g24670.1.25.224Bradi3g24670.1.25.224Bradi4g26420.1Bradi3g57440.1
Bradi3g24670.1.227.515Bradi3g24670.1.227.515
Brassica rapaBra019976Bra019978Bra019979Bra013800Bra038506
Bra030804Bra011802Bra010630.46.641Bra010630.46.641Bra010629
Bra003366Bra010630.640.880Bra010630.640.880Bra010624.235.480Bra010624.235.480
Bra010624.235.480Bra010624.49.234Bra010624.49.234Bra010624.49.234
Carica papayaevm.model.supercontig_177.18evm.model.supercontig_177.19evm.TU.contig_29377.1evm.model.supercontig_21.45evm.model.supercontig_152.24
evm.TU.contig_29377.2evm.model.supercontig_129.7
Capsella rubellaCarubv10008508mCarubv10010965mCarubv10022775mCarubv10007831mCarubv10008518m
Carubv10007197mCarubv10022113mCarubv10004306m
Citrus clementinaCiclev10000543mCiclev10003131mCiclev10000542mCiclev10003466mCiclev10003807m
Ciclev10025074mCiclev10017592mCiclev10006424mCiclev10003567mCiclev10027111m
Ciclev10006636m
Citrus sinensisorange1.1g042458morange1.1g005706morange1.1g006741morange1.1g007269morange1.1g047026m
orange1.1g037887morange1.1g006927morange1.1g038979morange1.1g010135morange1.1g011661m
orange1.1g011825morange1.1g040991m
Cucumis sativusCucsa.312090.1Cucsa.312070.3Cucsa.312070.1Cucsa.312070.2Cucsa.160470.1
Cucsa.103830.1Cucsa.312080.1Cucsa.045150.2Cucsa.045150.1Cucsa.045150.3
Cucsa.260200.1Cucsa.260200.2
Eucalyptus grandisEucgr.F00442.2Eucgr.F00442.1Eucgr.F00441.1Eucgr.I00574.2Eucgr.I00574.1
Eucgr.F00438.2Eucgr.F00438.1Eucgr.F00439.2Eucgr.F00439.1Eucgr.D01343.1
Eucgr.H02416.1.178.655Eucgr.H02416.1.178.655
Fragaria vescamrna26587.1-v1.0-hybrid.575.949mrna26587.1-v1.0-hybrid.575.949mrna26587.1-v1.0-hybrid.575.949mrna26581.1-v1.0-hybrid.167.770mrna26581.1-v1.0-hybrid.167.770
mrna31031.1-v1.0-hybrid.42.277mrna31031.1-v1.0-hybrid.42.277mrna05694.1-v1.0-hybridmrna19639.1-v1.0-hybridmrna24966.1-v1.0-hybrid.55.661
mrna24966.1-v1.0-hybrid.55.661mrna31030.1-v1.0-hybridmrna26580.1-v1.0-hybridmrna26077.1-v1.0-hybridmrna31031.1-v1.0-hybrid.280.619
mrna31031.1-v1.0-hybrid.280.619mrna26585.1-v1.0-hybridmrna26587.1-v1.0-hybrid.381.517mrna26587.1-v1.0-hybrid.381.517mrna26587.1-v1.0-hybrid.381.517
Glycine maxGlyma06g09760.3Glyma06g09760.2Glyma06g09770.3Glyma06g09770.1Glyma04g09670.1
Glyma04g09680.1Glyma04g09680.2Glyma02g38050.1Glyma18g27090.4Glyma18g27090.3
Glyma18g27090.2Glyma01g02560.1Glyma09g33400.3Glyma09g33400.2Glyma08g37410.1
Glyma08g37420.2Glyma04g09660.2.40.282Glyma04g09660.2.40.282Glyma04g09660.2.283.511Glyma04g09660.2.283.511
Glyma02g38061.1.329.504Glyma02g38061.1.329.504Glyma14g36201.1.210.328Glyma14g36201.1.210.328
Gossypium raimondiiGorai.010G032900.1Gorai.010G032900.2Gorai.009G227700.1Gorai.002G138200.5Gorai.002G138200.4
Gorai.002G138200.1Gorai.010G033000.1Gorai.009G227800.2Gorai.009G227700.2Gorai.009G227800.1
Gorai.002G138200.2Gorai.007G231600.1Gorai.007G231600.2Gorai.003G036400.1Gorai.007G231600.3
Gorai.008G089300.3Gorai.008G089300.1Gorai.008G089300.2Gorai.003G036600.1Gorai.002G138200.3
Gorai.008G089100.1
Linum usitatissimumLus10000684Lus10028212Lus10039627Lus10019231Lus10004281
Lus10030233Lus10000129Lus10012720Lus10000111Lus10005979
Lus10029552Lus10023106Lus10030232Lus10005978.157.600Lus10005978.157.600
Lus10010739Lus10042916Lus10010738.186.385Lus10010738.186.385Lus10010738.15.184
Lus10010738.15.184Lus10010628
Malus domesticaMDP0000121223MDP0000910440MDP0000726337.390.638MDP0000726337.390.638MDP0000726337.390.638
MDP0000310168MDP0000253529MDP0000600662MDP0000816794MDP0000265455
MDP0000144890MDP0000221905MDP0000280501.221.597MDP0000280501.221.597MDP0000661406
MDP0000186551MDP0000161615MDP0000726337.184.393MDP0000726337.184.393MDP0000726337.184.393
MDP0000502670MDP0000315307
Manihot esculentacassava4.1_003508mcassava4.1_003506mcassava4.1_031112mcassava4.1_028655mcassava4.1_029675m
cassava4.1_021251mcassava4.1_026462mcassava4.1_029993mcassava4.1_026195mcassava4.1_031565m
cassava4.1_021266m.240.400cassava4.1_021266m.240.400
Medicago truncatulaMedtr3g111410.1Medtr3g111420.1Medtr5g066770.1Medtr3g111380.1Medtr8g068110.1
Medtr8g068120.1Medtr8g068160.1Medtr5g031170.1
Mimulus guttatusmgv1a002779mmgv1a002710mmgv1a002454mmgv1a003154mmgv1a022558m
mgv1a002827mmgv1a019191mmgv1a002612mmgv1a018512mmgv1a023316m
mgv1a019441mmgv1a025746m
Oryza sativaLOC_Os08g44020.3LOC_Os08g44020.2LOC_Os08g44020.1LOC_Os08g44040.1
Panicum virgatumPavirv00037365mPavirv00030733mPavirv00008158mPavirv00023932mPavirv00012626m
Pavirv00032832mPavirv00051498mPavirv00066561mPavirv00016001m
Physcomitrella patensPp1s117_149V6.1Pp1s60_134V6.1
Phaseolus vulgarisPhvul.009G144900.2Phvul.009G144900.1Phvul.009G144800.1Phvul.009G144700.1Phvul.003G287200.1
Phvul.008G183500.1Phvul.002G144400.1Phvul.009G144900.3Phvul.003G287300.1
Picea abiesMA_2550g0010MA_10429122g0010MA_10434775g0010MA_228529g0010MA_10429048g0010
Populus trichocarpaPotri.005G151500.2Potri.005G151500.3Potri.005G151500.1Potri.002G110000.1Potri.002G110200.2
Potri.002G110200.1Potri.014G004500.3Potri.014G004500.1Potri.014G004500.2Potri.006G218500.1
Potri.002G110100.1Potri.006G253600.3Potri.006G253600.2Potri.002G110300.2Potri.002G110300.1
Potri.006G218500.2Potri.002G110000.2Potri.006G253600.1.352.549Potri.006G253600.1.352.549Potri.005G151600.1
Prunus persicappa002905mppa026307mppa002544mppa002538mppa002258m
ppa022021mppa014556m
Ricinus communis29596.m00070129596.m00070229596.m00070729596.m00070628333.m000588
29596.m00070528333.m00057229842.m003574.19.21929842.m003574.19.21929842.m003574.232.356
29842.m003574.232.356
Setaria italicaSi013393mSi013400mSi012557mSi027699mSi024658m
Si027587m
Selaginella moellendorffii130257425248413798413794.293.533413794.293.533
Sorghum bicolorSb07g024560.1Sb08g001440.1Sb09g030850.1Sb05g001996.1Sb05g018090.1
Sb05g001980.1
Thellungiella halophilaThhalv10007058mThhalv10007093mThhalv10000697mThhalv10007038mThhalv10024647m
Thhalv10027081mThhalv10024612mThhalv10007521m
Vitis viniferaGSVIVT01009215001GSVIVT01012710001GSVIVT01006298001GSVIVT01006302001.272.736GSVIVT01006302001.272.736
GSVIVT01006463001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)