Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.011G033100.1 |
Family | AA6 |
Protein Properties | Length: 204 Molecular Weight: 21692.9 Isoelectric Point: 6.5232 |
Chromosome | Chromosome/Scaffold: 11 Start: 2715930 End: 2719130 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 4 | 198 | 0 |
KIYIIYYSMYGHVARLAEEIKKGADTVEGVEIKLWQVPETLPEEVLGKMGAPPKSDVPIIKPNDLTEADGVLFGFPTRFGMMAAQFKAFLDATGGLWGTQ QLAGKPAGIFFSTASQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTFAGDGTRQPTELELGQAFHQGKYFAGIAKK |
Full Sequence |
---|
Protein Sequence Length: 204 Download |
MAVKIYIIYY SMYGHVARLA EEIKKGADTV EGVEIKLWQV PETLPEEVLG KMGAPPKSDV 60 PIIKPNDLTE ADGVLFGFPT RFGMMAAQFK AFLDATGGLW GTQQLAGKPA GIFFSTASQG 120 GGQETTALTA ITQLVHHGMI FVPIGYTFGA GMFEMEQVKG GSPYGAGTFA GDGTRQPTEL 180 ELGQAFHQGK YFAGIAKKFK GTT* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam00258 | Flavodoxin_1 | 5.0e-13 | 7 | 138 | 145 | + Flavodoxin. |
pfam03358 | FMN_red | 1.0e-15 | 17 | 146 | 131 | + NADPH-dependent FMN reductase. |
COG0655 | WrbA | 5.0e-44 | 1 | 201 | 208 | + Multimeric flavodoxin WrbA [General function prediction only] |
TIGR01755 | flav_wrbA | 2.0e-67 | 3 | 198 | 197 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
PRK03767 | PRK03767 | 7.0e-81 | 3 | 201 | 200 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0010181 | FMN binding |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002304974.1 | 0 | 1 | 202 | 1 | 202 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002316697.1 | 0 | 1 | 203 | 1 | 203 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002319258.1 | 0 | 1 | 201 | 1 | 201 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002518592.1 | 0 | 1 | 202 | 1 | 202 | Flavoprotein wrbA, putative [Ricinus communis] |
RefSeq | XP_002534445.1 | 0 | 1 | 202 | 1 | 202 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0 | 4 | 201 | 3 | 198 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6m_A | 0 | 4 | 201 | 3 | 198 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6k_B | 0 | 4 | 201 | 3 | 198 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6k_A | 0 | 4 | 201 | 3 | 198 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6j_B | 0 | 4 | 201 | 3 | 198 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BU867681 | 204 | 1 | 204 | 0 |
BU868997 | 204 | 1 | 204 | 0 |
DN487328 | 204 | 1 | 204 | 0 |
DT487242 | 204 | 1 | 204 | 0 |
BU869299 | 204 | 1 | 204 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|