| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.011G042200.1 |
| Family | CE8 |
| Protein Properties | Length: 104 Molecular Weight: 11642.2 Isoelectric Point: 9.0352 |
| Chromosome | Chromosome/Scaffold: 11 Start: 3574954 End: 3575825 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 14 | 93 | 3e-22 |
| KGVRAYLGRAFRPYSTVVYLSEVVEPAGWSPWHYQGHERDFTYAEVNCKGRGSDISKRVPWEKKLDAQQINQFSKSSFID | |||
| Full Sequence |
|---|
| Protein Sequence Length: 104 Download |
| MPPAAITSPI ATLKGVRAYL GRAFRPYSTV VYLSEVVEPA GWSPWHYQGH ERDFTYAEVN 60 CKGRGSDISK RVPWEKKLDA QQINQFSKSS FIDQDGWLAN LPL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02671 | PLN02671 | 6.0e-19 | 19 | 98 | 84 | + pectinesterase | ||
| PLN02480 | PLN02480 | 3.0e-19 | 19 | 98 | 84 | + Probable pectinesterase | ||
| PLN02304 | PLN02304 | 3.0e-20 | 17 | 98 | 88 | + probable pectinesterase | ||
| PLN02176 | PLN02176 | 2.0e-27 | 12 | 103 | 97 | + putative pectinesterase | ||
| PLN02497 | PLN02497 | 4.0e-30 | 17 | 103 | 91 | + probable pectinesterase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB61046.1 | 2e-26 | 18 | 102 | 153 | 242 | Similar to pectinesterase; F2P16.5 [Arabidopsis thaliana] |
| RefSeq | XP_002317244.1 | 0 | 1 | 103 | 1 | 103 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002318946.1 | 1e-31 | 10 | 103 | 242 | 339 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002330032.1 | 2e-38 | 10 | 103 | 227 | 324 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002529267.1 | 1e-28 | 17 | 102 | 248 | 337 | Pectinesterase-2 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0.00001 | 19 | 98 | 222 | 308 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.00002 | 13 | 98 | 212 | 304 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EG986402 | 89 | 20 | 103 | 5e-29 |
| JG245642 | 97 | 10 | 102 | 1e-26 |
| JG234805 | 97 | 10 | 102 | 2e-26 |
| JG231651 | 97 | 10 | 102 | 2e-26 |
| EV111034 | 92 | 16 | 102 | 5e-26 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |