CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.011G061000.1
FamilyGT1
Protein PropertiesLength: 463 Molecular Weight: 51407.4 Isoelectric Point: 6.5066
ChromosomeChromosome/Scaffold: 11 Start: 5451888 End: 5453414
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12354406.8e-22
  DQFGKPVILAGPIVPEPPNSVLEEKIAKMLDSFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVLKPPIGAETIESALPEGFEERVKGRGLVY
  TGWVQQQLILRHPSVGCFVTHCGSGSLSEGMVNKCQLVLLPNVGDQIINARVVGGDLKVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSEVGKLVRANHA
  KWREFL
Full Sequence
Protein Sequence     Length: 463     Download
MSTNIAARSS KALHIAMYPW FALGHLTAFV HFSNKLAERG HRVSFFLPKK TQSKFEPFNL    60
HPDLITFIPI TVPHVDGLPT GTETTTDVPF PLHPLLMTAM DLTEHVIEDH LRILNPHFIF    120
FDFTHWLPEL SRKHGIKSVH FCIISPATIG YTLSPERKLE SLTAADLMQP PPSFPPSSIK    180
LRAHEARGIC AVTVKQFGSN ISFQERNIYS LSQCDAIAFK ACREMEGPYS DYIEDQFGKP    240
VILAGPIVPE PPNSVLEEKI AKMLDSFKAE TLVFCAFGSE CILKKDQFQE LVLGLELTSL    300
PFFAVLKPPI GAETIESALP EGFEERVKGR GLVYTGWVQQ QLILRHPSVG CFVTHCGSGS    360
LSEGMVNKCQ LVLLPNVGDQ IINARVVGGD LKVGVEVKKG EEDGLFTRHG VCEAVKAVMD    420
DDSEVGKLVR ANHAKWREFL LGKELENSYV DGFVHKLHEL LE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028636.0e-444451471+
PLN02670PLN026704.0e-8913459474+
PLN00414PLN004144.0e-15013457448+
PLN02764PLN027642.0e-15613461453+
PLN02208PLN022082.0e-15713461452+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU24192.1094622458unknown [Glycine max]
DDBJBAD95881.10144619458glucosyltransferase [Ipomoea nil]
DDBJBAD95882.10144619458glucosyltransferase [Ipomoea purpurea]
RefSeqXP_002331944.10174621446predicted protein [Populus trichocarpa]
RefSeqXP_002522508.10114614456UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A4e-22240438235444A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB2vch_A4e-22240438235444A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB2vce_A4e-22240438235444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A6e-19197438193427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A6e-19197438193427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Transmembrane Domains
StartEnd
1332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778286427404630
DY27255433863410
CB292845299263220
FC90626928962920
HO7782862416390.012
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)