Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.011G099000.1 |
Family | CBM43 |
Protein Properties | Length: 121 Molecular Weight: 13448.3 Isoelectric Point: 7.7686 |
Chromosome | Chromosome/Scaffold: 11 Start: 12076317 End: 12077079 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 37 | 117 | 1.3e-30 |
WCVAKPSSDQATLLANINYACSHVDCQILQKGYPCFSPDSLISHASIAMNLYYQRKGRNHWNCDFRDSGLIVKTDPSYSNC |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
MATPSLMPWK RATTEAILAM DIHHCGSSVM ANEQRTWCVA KPSSDQATLL ANINYACSHV 60 DCQILQKGYP CFSPDSLISH ASIAMNLYYQ RKGRNHWNCD FRDSGLIVKT DPSYSNCIYA 120 * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-16 | 36 | 105 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-32 | 36 | 119 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002300444.1 | 0 | 26 | 120 | 21 | 115 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002331313.1 | 0 | 34 | 113 | 22 | 101 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 0 | 1 | 120 | 1 | 120 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002333741.1 | 0 | 34 | 113 | 1 | 80 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 0 | 26 | 120 | 21 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-25 | 36 | 119 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV272358 | 105 | 17 | 121 | 0 |
AJ774139 | 93 | 29 | 121 | 0 |
DT519515 | 93 | 29 | 121 | 0 |
CF236994 | 94 | 28 | 121 | 0 |
DT513937 | 93 | 29 | 121 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|