Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.011G099600.1 |
Family | CBM43 |
Protein Properties | Length: 118 Molecular Weight: 13209.4 Isoelectric Point: 9.1034 |
Chromosome | Chromosome/Scaffold: 11 Start: 12115999 End: 12116436 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 34 | 114 | 8.7e-29 |
WCVAKPSSDQATLLANINYACSHVDCQILQKGYPCFSPDSLISHASIAMNLYYQCKGRNRWNCDFRDSGLIVKTGPSYSNC |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
MESKRIQLKL GKFLVVYCPN SKKFALTIIL QKTWCVAKPS SDQATLLANI NYACSHVDCQ 60 ILQKGYPCFS PDSLISHASI AMNLYYQCKG RNRWNCDFRD SGLIVKTGPS YSNCIYA* 120 |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 1.0e-14 | 33 | 102 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 1.0e-29 | 33 | 116 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002300444.1 | 0 | 31 | 117 | 29 | 115 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002331313.1 | 0 | 10 | 110 | 1 | 101 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 0 | 31 | 117 | 34 | 120 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002333741.1 | 0 | 31 | 110 | 1 | 80 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 0 | 1 | 117 | 1 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-24 | 33 | 116 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AJ774139 | 88 | 31 | 118 | 0 |
DT519515 | 88 | 31 | 118 | 0 |
CV272358 | 88 | 31 | 118 | 0 |
DT513937 | 88 | 31 | 118 | 0 |
DT509324 | 88 | 31 | 118 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |