| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.012G113000.1 |
| Family | CE8 |
| Protein Properties | Length: 128 Molecular Weight: 14041.1 Isoelectric Point: 8.8412 |
| Chromosome | Chromosome/Scaffold: 12 Start: 13401239 End: 13402048 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 20 | 114 | 2.4e-39 |
| EDQAVALRSGGDKAAFYNCRLIGFQDTLCDDKGRHFFKNCYIEGTVDFISGSGKSLYLGTKINVLADQGLAEITAQARHKEDDTGFCFVHCKVNG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 128 Download |
| MPRPNTGILL QLRRSGRLKE DQAVALRSGG DKAAFYNCRL IGFQDTLCDD KGRHFFKNCY 60 IEGTVDFISG SGKSLYLGTK INVLADQGLA EITAQARHKE DDTGFCFVHC KVNGIGKALG 120 WCLLTQR* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02497 | PLN02497 | 2.0e-30 | 23 | 118 | 101 | + probable pectinesterase | ||
| PLN02634 | PLN02634 | 2.0e-31 | 22 | 120 | 105 | + probable pectinesterase | ||
| PLN02432 | PLN02432 | 2.0e-34 | 21 | 119 | 100 | + putative pectinesterase | ||
| PLN02682 | PLN02682 | 2.0e-34 | 22 | 116 | 96 | + pectinesterase family protein | ||
| PLN02665 | PLN02665 | 1.0e-66 | 2 | 117 | 117 | + pectinesterase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002309337.1 | 9.94922e-44 | 13 | 116 | 171 | 275 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002318197.1 | 1.96182e-44 | 2 | 116 | 166 | 271 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002318198.1 | 0 | 1 | 119 | 1 | 119 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002321778.1 | 0 | 13 | 124 | 168 | 275 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002333446.1 | 1.00053e-42 | 13 | 116 | 168 | 272 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2ntq_B | 0.000000000009 | 15 | 76 | 122 | 185 | A Chain A, Peanut Peroxidase |
| PDB | 2ntq_A | 0.000000000009 | 15 | 76 | 122 | 185 | A Chain A, Peanut Peroxidase |
| PDB | 2ntp_B | 0.000000000009 | 15 | 76 | 122 | 185 | A Chain A, Peanut Peroxidase |
| PDB | 2ntp_A | 0.000000000009 | 15 | 76 | 122 | 185 | A Chain A, Peanut Peroxidase |
| PDB | 2ntb_B | 0.000000000009 | 15 | 76 | 122 | 185 | A Chain A, Crystal Structure Of Pectin Methylesterase In Complex With Hexasaccharide V |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DY276346 | 123 | 13 | 124 | 5e-40 |
| EE260069 | 94 | 22 | 114 | 1e-39 |
| DY291667 | 105 | 13 | 116 | 1e-39 |
| DY263772 | 105 | 13 | 116 | 2e-39 |
| DY266986 | 105 | 13 | 116 | 2e-39 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_9008g0020 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |