Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.014G116800.3 |
Family | GT8 |
Protein Properties | Length: 226 Molecular Weight: 25579.4 Isoelectric Point: 5.2851 |
Chromosome | Chromosome/Scaffold: 14 Start: 9071951 End: 9073990 |
Description | galactinol synthase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 24 | 207 | 5.9e-40 |
RAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRRILESQGCIVREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD IQVYDNIDHLFDLPDGHFYAVMDCFCEKTWSHTPQYKIGYCQQCPDKVNWPAEMGQPPSLYFNAGMFVFEPSISTYHDLLKTLK |
Full Sequence |
---|
Protein Sequence Length: 226 Download |
MAPELVQAAL KPAGFTKPAS LPSRAYVTFL AGNGDYVKGV VGLAKGLRKV KTAYPLIVAV 60 LPDVPEEHRR ILESQGCIVR EIEPVYPPEN QTQFAMAYYV INYSKLRIWE FVEYSKMIYL 120 DGDIQVYDNI DHLFDLPDGH FYAVMDCFCE KTWSHTPQYK IGYCQQCPDK VNWPAEMGQP 180 PSLYFNAGMF VFEPSISTYH DLLKTLKVTP PTPFAEQVWC SDPSF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00505 | Glyco_transf_8 | 4.0e-9 | 27 | 204 | 186 | + Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+. | ||
COG5597 | COG5597 | 2.0e-10 | 99 | 204 | 127 | + Alpha-N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | ||
pfam01501 | Glyco_transf_8 | 6.0e-43 | 27 | 217 | 208 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. | ||
cd02537 | GT8_Glycogenin | 5.0e-64 | 24 | 217 | 194 | + Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. | ||
PLN00176 | PLN00176 | 2.0e-170 | 1 | 217 | 217 | + galactinol synthase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016757 | transferase activity, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACA04033.1 | 0 | 1 | 217 | 1 | 217 | galactinol synthase 4 [Populus trichocarpa x Populus deltoides] |
EMBL | CAN79630.1 | 0 | 1 | 217 | 1 | 217 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002301531.1 | 0 | 1 | 217 | 1 | 217 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002320958.1 | 0 | 1 | 217 | 1 | 217 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002515233.1 | 0 | 1 | 217 | 1 | 217 | conserved hypothetical protein [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3u2w_B | 0.00000000000004 | 20 | 203 | 1 | 151 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) Complexed With Manganese |
PDB | 3u2w_A | 0.00000000000004 | 20 | 203 | 1 | 151 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) Complexed With Manganese |
PDB | 3qvb_A | 0.00000000000004 | 20 | 203 | 1 | 151 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) Complexed With Manganese |
PDB | 3q4s_A | 0.00000000000004 | 20 | 203 | 1 | 151 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1), Apo Form |
PDB | 3u2x_B | 0.00000000000004 | 20 | 203 | 1 | 151 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1), Apo Form |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
stachyose biosynthesis | 2.4.1.123-RXN | EC-2.4.1.123 | inositol 3-α-galactosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CA932152 | 217 | 1 | 217 | 0 |
CA931818 | 217 | 1 | 217 | 0 |
CA931829 | 217 | 1 | 217 | 0 |
EG694044 | 215 | 1 | 215 | 0 |
DT736183 | 217 | 1 | 217 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|