Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.014G126800.1 |
Family | GT4 |
Protein Properties | Length: 207 Molecular Weight: 23603.2 Isoelectric Point: 9.3111 |
Chromosome | Chromosome/Scaffold: 14 Start: 9738844 End: 9740178 |
Description | sucrose synthase 3 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 37 | 157 | 7.1e-24 |
MTGSVECCGKNTKLREQVNLDIVADYIDVKKSKDREQIQEIERMHALMKKYKLDGQFHWITAQTNRARNGELYRYIADTKGAFVQPAFYEAFGLTVVEAN ICGCHGGPAEIIGHGLSGFHI |
Full Sequence |
---|
Protein Sequence Length: 207 Download |
MSHAAFTLPG LYRVVHVIDV FYPKFNIAGP RQEHDTMTGS VECCGKNTKL REQVNLDIVA 60 DYIDVKKSKD REQIQEIERM HALMKKYKLD GQFHWITAQT NRARNGELYR YIADTKGAFV 120 QPAFYEAFGL TVVEANICGC HGGPAEIIGH GLSGFHIILT RLLHLWHCSL KSARRIQATG 180 KKISDAGLQR IYERYTWKIY SERLMT* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
TIGR02470 | sucr_synth | 1.0e-10 | 2 | 30 | 29 | + sucrose synthase. This model represents sucrose synthase, an enzyme that, despite its name, generally uses rather produces sucrose. Sucrose plus UDP (or ADP) becomes D-fructose plus UDP-glucose (or ADP-glucose), which is then available for cell wall (or starch) biosynthesis. The enzyme is homologous to sucrose phosphate synthase, which catalyzes the penultimate step in sucrose synthesis. Sucrose synthase is found, so far, exclusively in plants and cyanobacteria [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
TIGR02472 | sucr_P_syn_N | 3.0e-14 | 37 | 203 | 174 | + sucrose-phosphate synthase, putative, glycosyltransferase domain. This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (TIGR02471), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant SPS. At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase. | ||
cd03800 | GT1_Sucrose_synthase | 8.0e-32 | 41 | 206 | 179 | + This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light. | ||
TIGR02470 | sucr_synth | 7.0e-77 | 37 | 206 | 182 | + sucrose synthase. This model represents sucrose synthase, an enzyme that, despite its name, generally uses rather produces sucrose. Sucrose plus UDP (or ADP) becomes D-fructose plus UDP-glucose (or ADP-glucose), which is then available for cell wall (or starch) biosynthesis. The enzyme is homologous to sucrose phosphate synthase, which catalyzes the penultimate step in sucrose synthesis. Sucrose synthase is found, so far, exclusively in plants and cyanobacteria [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
PLN00142 | PLN00142 | 8.0e-107 | 2 | 206 | 271 | + sucrose synthase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005985 | sucrose metabolic process |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC28175.1 | 0 | 2 | 206 | 486 | 753 | T2H3.8 [Arabidopsis thaliana] |
DDBJ | BAA88904.1 | 0 | 2 | 206 | 498 | 765 | sucrose synthase [Citrus unshiu] |
DDBJ | BAA88981.1 | 0 | 2 | 206 | 498 | 765 | sucrose synthase [Citrus unshiu] |
RefSeq | NP_192137.1 | 0 | 2 | 206 | 498 | 765 | SUS3 (sucrose synthase 3); UDP-glycosyltransferase/ sucrose synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana] |
RefSeq | XP_002523115.1 | 0 | 2 | 206 | 462 | 729 | sucrose synthase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3s29_H | 0 | 2 | 206 | 498 | 764 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3s29_G | 0 | 2 | 206 | 498 | 764 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3s29_F | 0 | 2 | 206 | 498 | 764 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3s29_E | 0 | 2 | 206 | 498 | 764 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3s29_D | 0 | 2 | 206 | 498 | 764 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
galactose degradation III | SUCROSE-SYNTHASE-RXN | EC-2.4.1.13 | sucrose synthase |
sucrose degradation III | SUCROSE-SYNTHASE-RXN | EC-2.4.1.13 | sucrose synthase |
UDP-glucose biosynthesis (from sucrose) | SUCROSE-SYNTHASE-RXN | EC-2.4.1.13 | sucrose synthase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO264238 | 268 | 2 | 206 | 0 |
GO267563 | 268 | 2 | 206 | 0 |
BU814899 | 180 | 36 | 206 | 0 |
GW392358 | 179 | 36 | 205 | 0 |
CX044829 | 180 | 36 | 206 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|