y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.015G100600.1
FamilyGH18
Protein PropertiesLength: 313 Molecular Weight: 34329.5 Isoelectric Point: 5.9491
ChromosomeChromosome/Scaffold: 15 Start: 11919871 End: 11921461
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18652314.3e-23
  FHFIIAFAIDYTGLENPSPTNGKFNAFWASSHVTPEEIASVKDKHSNVKVAVSLGGDSVGSKKAFFAPKSIDSWVQNAISSLTSMIKQYNLDGIDIDYEH
  FKSDPHTFAECVGRLITTLKKSRTISFASIAPYDDGEVQSHYLALWKKYGHAIDHVNFQFYAYEKSS
Full Sequence
Protein Sequence     Length: 313     Download
MILGESALDS WVVRKPFLSL LITSILILFF TTGNAANSKL FREYIGAMSS SIKLSDVPVS    60
SNVEFHFIIA FAIDYTGLEN PSPTNGKFNA FWASSHVTPE EIASVKDKHS NVKVAVSLGG    120
DSVGSKKAFF APKSIDSWVQ NAISSLTSMI KQYNLDGIDI DYEHFKSDPH TFAECVGRLI    180
TTLKKSRTIS FASIAPYDDG EVQSHYLALW KKYGHAIDHV NFQFYAYEKS SVSQFVKHFD    240
EQASNYGGGQ ILASFSTDDE SEGGLDPDGG FFEACKELQG KEKLGGIFIW SADNSKKHGF    300
EGEKNSQHLL AA*                                                       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06545GH18_3CO4_chitinase3.0e-959240199+
smart00636Glyco_188.0e-1066259212+
pfam00704Glyco_hydro_183.0e-1266227170+
cd00598GH18_chitinase-like4.0e-1566225165+
cd06544GH18_narbonin8.0e-11540295257+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76732.103529424281hypothetical protein [Vitis vinifera]
EMBLCAN76732.1037311312585hypothetical protein [Vitis vinifera]
RefSeqXP_002281665.10173117301PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281676.10133121298PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321723.10373121276predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B0403122275A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A0403122275A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A3e-36403124289A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB2y8v_D0.00046622544198A Chain A, Structure Of Chitinase, Chic, From Aspergillus Fumigatus.
PDB2y8v_C0.00046622544198A Chain A, Structure Of Chitinase, Chic, From Aspergillus Fumigatus.
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Transmembrane Domains
StartEnd
1736
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA927738228452720
CA928955221452650
CA9278301891253130
FQ317099268453110
FQ317071268453110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_046_00008.1Aquca_014_00353.1Aquca_010_00636.1Aquca_027_00184.1
Brachypodium distachyonBradi3g26850.1Bradi3g26810.1Bradi3g26840.1
Carica papayaevm.model.supercontig_139.6
Citrus clementinaCiclev10028881mCiclev10003729m
Citrus sinensisorange1.1g021511morange1.1g046094m
Eucalyptus grandisEucgr.B02439.1Eucgr.J02106.1
Fragaria vescamrna14033.1-v1.0-hybrid.59.211mrna14019.1-v1.0-hybridmrna15882.1-v1.0-hybridmrna14034.1-v1.0-hybridmrna17899.1-v1.0-hybrid
mrna22564.1-v1.0-hybrid
Glycine maxGlyma11g15512.1Glyma09g21615.1Glyma13g40590.1
Gossypium raimondiiGorai.003G135700.1Gorai.003G135800.1Gorai.003G134100.1Gorai.003G129600.1Gorai.011G120000.1
Gorai.003G138400.1
Linum usitatissimumLus10005172
Malus domesticaMDP0000904158MDP0000885802MDP0000644797MDP0000312089
Manihot esculentacassava4.1_024209mcassava4.1_027074m
Medicago truncatulaMedtr6g079630.1Medtr2g096030.1
Mimulus guttatusmgv1a019267mmgv1a024804m
Oryza sativaLOC_Os10g28050.1LOC_Os10g28080.1
Panicum virgatumPavirv00061810mPavirv00014582mPavirv00031712m
Phaseolus vulgarisPhvul.011G069900.1
Picea abiesMA_38396g0010MA_10427109g0010
Populus trichocarpaPotri.012G102400.1Potri.015G100500.1Potri.001G341700.1
Prunus persicappa023801mppa009038mppa009096m
Ricinus communis30039.m00023530039.m000234
Setaria italicaSi022612mSi026720mSi028172mSi036765mSi036774m
Selaginella moellendorffii41118115493
Sorghum bicolorSb01g021920.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny