Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.016G008900.1 |
Family | CBM43 |
Protein Properties | Length: 70 Molecular Weight: 7708.71 Isoelectric Point: 8.6409 |
Chromosome | Chromosome/Scaffold: 16 Start: 448975 End: 449184 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 65 | 2e-23 |
VNWACGKGGADCRKIQRNQPCYPPSTARDHASYAFDNSYQKFKHEGATCYFNAAALITDLDPSK |
Full Sequence |
---|
Protein Sequence Length: 70 Download |
RVNWACGKGG ADCRKIQRNQ PCYPPSTARD HASYAFDNSY QKFKHEGATC YFNAAALITD 60 LDPSKIILL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-9 | 2 | 56 | 60 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-20 | 2 | 64 | 63 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 4e-32 | 2 | 65 | 47 | 110 | unknown [Populus trichocarpa] |
RefSeq | XP_002307902.1 | 5e-32 | 2 | 65 | 46 | 109 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002323134.1 | 5.04467e-44 | 1 | 69 | 28 | 96 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002337363.1 | 6.02558e-44 | 2 | 69 | 1 | 68 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 2e-30 | 2 | 64 | 45 | 107 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000001 | 1 | 64 | 28 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT500003 | 64 | 2 | 65 | 2e-31 |
CV272267 | 64 | 2 | 65 | 6e-31 |
CV246773 | 64 | 2 | 65 | 9e-31 |
DT035040 | 63 | 2 | 64 | 2e-28 |
EE090966 | 63 | 2 | 64 | 4e-28 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|