CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.016G095900.4
FamilyGT30
Protein PropertiesLength: 378 Molecular Weight: 42298 Isoelectric Point: 10.0259
ChromosomeChromosome/Scaffold: 16 Start: 9156237 End: 9163101
DescriptionKDO transferase A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30432220
  RLPERLGRPSLTRPPGPLLWFHAVSLGEGMAAIPVIKECVKWRPDLNILLTTTTMSAFEVIINQLPTGVLHQFSPIDTPAAMDAFLDYWNPNAIMLLESE
  LWPNLIMASSRKGILLALLNARVSMKSFKLWSSPVLFPLISLLLSKFSLIIPLSSMQAIHFQLLQAPPFIINFAGDLKYV
Full Sequence
Protein Sequence     Length: 378     Download
MGVVARKGML VYKIYRALSY VVSPLLQLHL RWRKIRGLEH PTRLPERLGR PSLTRPPGPL    60
LWFHAVSLGE GMAAIPVIKE CVKWRPDLNI LLTTTTMSAF EVIINQLPTG VLHQFSPIDT    120
PAAMDAFLDY WNPNAIMLLE SELWPNLIMA SSRKGILLAL LNARVSMKSF KLWSSPVLFP    180
LISLLLSKFS LIIPLSSMQA IHFQLLQAPP FIINFAGDLK YVVEYDASKE EFRSIDDLKV    240
QLGHRKVWMA SSIHRGEEEV MLGVHKVLKQ VYPDLVTIIV PRYPQHGKDI AQKLQKEGQH    300
VALRSQHQRI VPGRNIYVVD TLGELRHLYR LTPIAVIGGS FFPGLAGHNI SEAAAAGCAV    360
LTGGYFLSGL VCYNRCM* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N2.0e-4640173136+
COG1519KdtA1.0e-8915366354+
PRK05749PRK057491.0e-9714366355+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0016740transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABE80128.2083664366Three-deoxy-D-manno-octulosonic-acid transferase, N-terminal [Medicago truncatula]
EMBLCBI30224.1033661368unnamed protein product [Vitis vinifera]
RefSeqXP_002277784.1033661368PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002322900.1013661369predicted protein [Populus trichocarpa]
RefSeqXP_002528642.10636783723-deoxy-d-manno-octulosonic-acid transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2xcu_D2e-225036533310A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
PDB2xcu_C2e-225036533310A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
PDB2xcu_B2e-225036533310A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
PDB2xcu_A2e-225036533310A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
PDB2xci_D2e-225036533310A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
Metabolic Pathways
Pathway NameReactionECProtein Name
KDO transfer to lipid IVA IKDOTRANS-RXNEC-2.4.99.12lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
KDO transfer to lipid IVA IKDOTRANS2-RXNEC-2.4.99.13(KDO)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
Transmembrane Domains
StartEnd
350372
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY266328357103660
DY279419317313470
FC917851311313410
DY288817352103610
FC901247303103120
Orthologous Group
SpeciesID
Arabidopsis lyrata325028
Arabidopsis thalianaAT5G03770.1
Brachypodium distachyonBradi2g55417.1
Brassica rapaBra009511
Carica papayaevm.model.supercontig_5.99
Capsella rubellaCarubv10000940m
Chlamydomonas reinhardtiiCre13.g583100.t1.3
Citrus clementinaCiclev10032390mCiclev10032645m
Cucumis sativusCucsa.039090.1
Eucalyptus grandisEucgr.A01566.1
Fragaria vescamrna30104.1-v1.0-hybrid
Glycine maxGlyma10g07520.1
Gossypium raimondiiGorai.009G409200.3Gorai.009G409200.4Gorai.009G409200.2Gorai.009G409200.1
Linum usitatissimumLus10033622Lus10017663
Malus domesticaMDP0000133066
Manihot esculentacassava4.1_023442mcassava4.1_007754m
Medicago truncatulaMedtr1g061560.1
Mimulus guttatusmgv1a006467m
Oryza sativaLOC_Os01g63840.2LOC_Os01g63840.1
Panicum virgatumPavirv00040033mPavirv00069505m
Physcomitrella patensPp1s441_14V6.1
Phaseolus vulgarisPhvul.007G224100.1
Picea abiesMA_159008g0430
Populus trichocarpaPotri.016G095900.3Potri.016G095900.6Potri.016G095900.1Potri.016G095900.5Potri.016G095900.2
Prunus persicappa025343m
Ricinus communis29815.m000507
Setaria italicaSi001596m
Selaginella moellendorffii76719
Sorghum bicolorSb03g040370.1
Thellungiella halophilaThhalv10013569m
Vitis viniferaGSVIVT01033751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny