CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.018G132500.4
FamilyGH13
Protein PropertiesLength: 679 Molecular Weight: 76825.6 Isoelectric Point: 5.8103
ChromosomeChromosome/Scaffold: 18 Start: 15326303 End: 15333732
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132466330
  TEFPGTYLGVVEKLGHLKELGVNCIELMPCHEFNELEYYDYNSVFGDYKVNFWGYSTVNYFSPMTRYSSAGTLNCGHDAINEFKLLVREAHKRGIEVFMD
  VVFNHTAEGNERGPILSFKGVDNSVYYMLAPKGEFYNYSGCGNTFNCNHPVVRQFILDCLRYWVIEMHVDGFRFDLASIMTRSSSLWDAVNVFGSPIEGD
  LVTTGTPLGSPPLIEMMSNDPILRDVKLIAEAWDAGGLYQVGMFPHWHIWSEWNGKYRDIVRQFIKGTDGFSGAFAECLCGSPGLYQEGGRKPWNSINFV
  CAHDGFTLADLVTYNEKHNLANGEDNNDGENHNNSWNCGQEGELASISVKKLRKRQMRNFFLCLMVSQGVPMIHMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 679     Download
MNLLHSTSHS VHVLKFISQF RSTPKFCLLK RNVTSNLENF GSNLFSNSTA SISIKAARDG    60
VDTAVVVEEE GPKLRKFQVF EGHPSPFGAT VRDGGVNFAI FSANAVSATL CLISLSDLPE    120
NRVTEQFFLD PLTNKTGDVW HVHLKGDFKD MLYGYKFDGS FSPEEGHYYD PSQIVLDPYA    180
KAVISRGDFG VLGSDDNCWP QMACMIPTAD DKFDWEGDSL LKYPQRDLIL YEMHVRGFTQ    240
HESSRTEFPG TYLGVVEKLG HLKELGVNCI ELMPCHEFNE LEYYDYNSVF GDYKVNFWGY    300
STVNYFSPMT RYSSAGTLNC GHDAINEFKL LVREAHKRGI EVFMDVVFNH TAEGNERGPI    360
LSFKGVDNSV YYMLAPKGEF YNYSGCGNTF NCNHPVVRQF ILDCLRYWVI EMHVDGFRFD    420
LASIMTRSSS LWDAVNVFGS PIEGDLVTTG TPLGSPPLIE MMSNDPILRD VKLIAEAWDA    480
GGLYQVGMFP HWHIWSEWNG KYRDIVRQFI KGTDGFSGAF AECLCGSPGL YQEGGRKPWN    540
SINFVCAHDG FTLADLVTYN EKHNLANGED NNDGENHNNS WNCGQEGELA SISVKKLRKR    600
QMRNFFLCLM VSQGVPMIHM GDEYGHTKGG NNNTYCHDNY INYFWWDKKE ESSSDFFRFC    660
RLMTKFRHQL AVNVSPLA* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145102.0e-13382667601+
PRK03705PRK037055.0e-15278656599+
cd11326AmyAc_Glg_debranch0213670463+
COG1523PulA068667622+
TIGR02100glgX_debranch081669610+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15317.104766942668isoamylase isoform 1 [Solanum tuberosum]
EMBLCBI40669.10167811695unnamed protein product [Vitis vinifera]
RefSeqXP_002308090.1016781713predicted protein [Populus trichocarpa]
RefSeqXP_002324659.1016781681predicted protein [Populus trichocarpa]
RefSeqXP_002529900.105167854684isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B08266615587A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vuy_A08266615587A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vr5_B08266615587A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vr5_A08266615587A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vnc_B08266615587A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002351814896690
HO8002351193154330
HO800235584304870
EL4073822783736500
FE7093342693886560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.3Potri.018G132500.2Potri.018G132500.1
Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)