CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.T106200.1
FamilyAA2
Protein PropertiesLength: 269 Molecular Weight: 29052.5 Isoelectric Point: 8.6544
ChromosomeChromosome/Scaffold: 158 Start: 13650 End: 16256
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2541792.6e-26
  LPAKLLRTHFHGCFVRGCDASVLVNSTANNTAEKDAIPNLSLVIDEIKTQLENTCPGKVSCADILALSARDSVAFQIIVVGRRDGIVSEALEAFTDIPSP
  FFNFSTPLQSFKSKGLSVHDLVVLSG
Full Sequence
Protein Sequence     Length: 269     Download
MKVKGFGVVV LTVSGFCQAA GGVEEEILQD ILPCCRGYIV RNVTWRRAAT SLNLPAKLLR    60
THFHGCFVRG CDASVLVNST ANNTAEKDAI PNLSLVIDEI KTQLENTCPG KVSCADILAL    120
SARDSVAFQI IVVGRRDGIV SEALEAFTDI PSPFFNFSTP LQSFKSKGLS VHDLVVLSGH    180
CNLVSNRLYN FTGKGDQDPS LNPTYRKGLF QSDAALLTNR TPNKIVGELL NSNVFFREFA    240
QPMKRMGAIG VLPGTSGEIR KKCSVINS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like2.0e-1056247245+
PLN03030PLN030303.0e-5039267289+
pfam00141peroxidase1.0e-5040226199+
cd00693secretory_peroxidase5.0e-10739266283+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABM66586.10826812325putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankABQ18321.10826812325putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankABQ23446.10826812325putative peroxidase [Cinnamomum micranthum f. kanehirae]
RefSeqXP_002270603.10826711322PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317707.10826810322predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A05826836304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qo4_A1.4013e-453926718304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1pa2_A1.4013e-453926718304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B6.02558e-445426732294A Chain A, Peanut Peroxidase
PDB1sch_A6.02558e-445426732294A Chain A, Peanut Peroxidase
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG683195268572690
EC926215256662670
EG68320629062400
FN700326270552690
CF831925259462480
Orthologous Group
SpeciesID
Brassica rapaBra008715
Carica papayaevm.model.supercontig_16.92evm.model.supercontig_2186.1
Citrus sinensisorange1.1g041339m
Eucalyptus grandisEucgr.L01603.1Eucgr.H03669.1Eucgr.H03668.1
Malus domesticaMDP0000572590
Mimulus guttatusmgv1a014238m
Panicum virgatumPavirv00056620mPavirv00020581mPavirv00056619mPavirv00054667mPavirv00057804m
Pavirv00055510mPavirv00021339m
Picea abiesMA_946965g0010MA_3930037g0010MA_10433598g0020MA_48212g0010MA_149004g0010
MA_142961g0010MA_7571130g0010MA_10431507g0030
Ricinus communis29726.m003967
Setaria italicaSi003834m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny