Basic Information | |
---|---|
Species | Physcomitrella patens |
Cazyme ID | Pp1s114_114V6.1 |
Family | AA6 |
Protein Properties | Length: 96 Molecular Weight: 10167.9 Isoelectric Point: 8.4873 |
Chromosome | Chromosome/Scaffold: 114 Start: 685436 End: 685723 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 11 | 84 | 4.8e-27 |
TLPADVLTNVNAPPKDESILVITAAQLPEADAFLFGIPTRYGTMSASMKVFFDSKGGLWRGQSLAGKPTGIFVQ |
Full Sequence |
---|
Protein Sequence Length: 96 Download |
MAGLVPLQLS TLPADVLTNV NAPPKDESIL VITAAQLPEA DAFLFGIPTR YGTMSASMKV 60 FFDSKGGLWR GQSLAGKPTG IFVQYIVQCK AMAFF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 7.0e-7 | 34 | 82 | 49 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 2.0e-12 | 39 | 90 | 53 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 7.0e-13 | 26 | 83 | 58 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 5.0e-16 | 11 | 83 | 73 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABR16990.1 | 4e-24 | 12 | 88 | 113 | 189 | unknown [Picea sitchensis] |
GenBank | ACJ85377.1 | 5e-22 | 10 | 83 | 51 | 124 | unknown [Medicago truncatula] |
GenBank | ACU23836.1 | 4e-22 | 1 | 88 | 85 | 172 | unknown [Glycine max] |
RefSeq | XP_001769382.1 | 8.40779e-45 | 11 | 82 | 1 | 72 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_001785483.1 | 2e-37 | 11 | 88 | 144 | 221 | predicted protein [Physcomitrella patens subsp. patens] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 0.0000000006 | 21 | 82 | 49 | 110 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 0.0000000006 | 21 | 82 | 49 | 110 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 0.0000000006 | 21 | 82 | 50 | 111 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 0.0000000006 | 21 | 82 | 50 | 111 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 0.0000000006 | 21 | 82 | 50 | 111 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DC914311 | 78 | 11 | 88 | 9e-38 |
DC937476 | 74 | 11 | 84 | 1e-37 |
DC932961 | 78 | 11 | 88 | 1e-37 |
BY947683 | 78 | 11 | 88 | 2e-37 |
DC931890 | 78 | 11 | 88 | 2e-37 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|