y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhyscomitrella patens
Cazyme IDPp1s17_180V6.1
FamilyAA1
Protein PropertiesLength: 565 Molecular Weight: 62543.9 Isoelectric Point: 9.8964
ChromosomeChromosome/Scaffold: 17 Start: 1220334 End: 1223811
Descriptionlaccase 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1315460
  KTHHLNWTVENKRVTRNCATVDIPTVNGRFPGPTIEVNEGDTLVIKVTNKQQYPVTLHWHGIKQFRTNYADGPAHITQCPIQPNKSYIYEFTLNDQRGTF
  FWHAHINWMRSTVHGALIVHPKKKAPYGAVAGEIPIIMGEFFGLHPNVVELGFINTLAPVENRTTLASTINGFPGPFFNCSSATKVYKVKKGKTYLLRII
  DAALNSDHYFAVANHSVTVVAADGNYLKPFKTSYVPMSPGQTTDVLIKFDKPCGRYYFGMNAGPVPAVGAPPPFVPAVSIFQYEGADSTTSPVVPVFPDR
  FNLAPLNAYHAKLKNLNRYHLPRKVDKSFLYVVGISSVNCIPSENCTRKIAGTMQNMTFDDPVGTSILEAYASGAKGVYTTDFPAQPPSLNVNTTRPDPH
  YLAGNRGTRLRELKFGSVVQVVLQNFFAFGVLDHPFHLHGHDFYVVGQNYGVYDPVQSPKTFNLKDPPLFNTIGVPNGGWVALRFKANNPGVWLLHCHFE
  RHKSWGMHQVFITRNG
Full Sequence
Protein Sequence     Length: 565     Download
MASMKMSSFK VLCFIAIIVA VFTQKAVATS KTHHLNWTVE NKRVTRNCAT VDIPTVNGRF    60
PGPTIEVNEG DTLVIKVTNK QQYPVTLHWH GIKQFRTNYA DGPAHITQCP IQPNKSYIYE    120
FTLNDQRGTF FWHAHINWMR STVHGALIVH PKKKAPYGAV AGEIPIIMGE FFGLHPNVVE    180
LGFINTLAPV ENRTTLASTI NGFPGPFFNC SSATKVYKVK KGKTYLLRII DAALNSDHYF    240
AVANHSVTVV AADGNYLKPF KTSYVPMSPG QTTDVLIKFD KPCGRYYFGM NAGPVPAVGA    300
PPPFVPAVSI FQYEGADSTT SPVVPVFPDR FNLAPLNAYH AKLKNLNRYH LPRKVDKSFL    360
YVVGISSVNC IPSENCTRKI AGTMQNMTFD DPVGTSILEA YASGAKGVYT TDFPAQPPSL    420
NVNTTRPDPH YLAGNRGTRL RELKFGSVVQ VVLQNFFAFG VLDHPFHLHG HDFYVVGQNY    480
GVYDPVQSPK TFNLKDPPLF NTIGVPNGGW VALRFKANNP GVWLLHCHFE RHKSWGMHQV    540
FITRNGVGKS QTLPGPKHPL PKCT*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal1.0e-4239542552+
pfam07732Cu-oxidase_35.0e-4738153118+
PLN02191PLN021915.0e-6514542568+
TIGR03388ascorbase2.0e-7332554573+
TIGR03389laccase031563545+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196158.1085636565LAC12 (laccase 12); laccase [Arabidopsis thaliana]
RefSeqXP_001755400.1015641564predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001766678.102456324570predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002277722.102656328574PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315131.101456315575laccase 90c [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0305541532A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1asq_A0305541532A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1asp_B0305541532A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1asp_A0305541532A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1aso_B0305541532A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE591979594105570
HO797675502765630
BJ1719681654015650
BJ6055271673995650
BJ6066161604065650
Orthologous Group
SpeciesID
Physcomitrella patensPp1s175_122V6.1Pp1s17_180V6.2Pp1s86_61V6.2Pp1s86_61V6.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny