CAZyme Information

Basic Information
SpeciesPhyscomitrella patens
Cazyme IDPp1s24_272V6.1
FamilyGH16
Protein PropertiesLength: 582 Molecular Weight: 65273.4 Isoelectric Point: 6.6122
ChromosomeChromosome/Scaffold: 24 Start: 2592911 End: 2594656
Descriptionxyloglucan endotransglucosylase/hydrolase 4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH164115533.1e-22
  CGGRLRSLNSYPSGKFSSRIKCAEGDTSGLLTSFYVSSGEGTITQDEIDFEFLGDNKRIVQTNFYVNGTSDNEQWVELDYDCSSGFHTYAIHYDQHQIKW
  FVDSKLVRTVVKEDQLRERLPYPTKRMFLYSSVWNASFVNDGG
Full Sequence
Protein Sequence     Length: 582     Download
MSTPNLASMR IGIAGLQLKE LRRAHIGLEQ HCRLQVEAMQ GALRDSSKKV FDDPNGARRE    60
LVRVQKLVQT CNLNLTAIGQ HLQSHDLLAK VGQSVASAES LIDQSEITGP LPSPQVESVN    120
DEASESVFET EGSAPSTLSS RVSEDRNSRQ TGLTPSINNL GPFPVPPKFE MSMSELVVDF    180
CSNHVIRTLS TAIIRLDRSC GGKFHTTAKY TSGVFTIRMR APANAPGMIN SFYISSNDGA    240
LDMISFDFVG NQPNRVLTAY AVNGNHEQKL KTFHMDFDTT AEFHQYTIKW DNEMIVWMVD    300
DVVLRTLRAS CVKDYPTKPG HIFGYSWDAS SLNDGAMAGR MNWLNAPYFM HFKNLQVTSP    360
LRRGDWVPPQ QKNVQRTSTN SIRPFVIDYC PWSVAADAEH DVDITFDKKG CGGRLRSLNS    420
YPSGKFSSRI KCAEGDTSGL LTSFYVSSGE GTITQDEIDF EFLGDNKRIV QTNFYVNGTS    480
DNEQWVELDY DCSSGFHTYA IHYDQHQIKW FVDSKLVRTV VKEDQLRERL PYPTKRMFLY    540
SSVWNASFVN DGGWTGKWHG MGELPFVARF KDVVAQYFSN E* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02176GH16_XET2.0e-23196357175+
cd02175GH16_lichenase2.0e-30390573196+
pfam00722Glyco_hydro_163.0e-31183343162+
pfam00722Glyco_hydro_168.0e-37404547145+
cd02176GH16_XET1.0e-38402572182+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001756795.15e-161983297144predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001756795.104035461144predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001759442.101973571161predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001759442.18e-174095722158predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001759443.104555772125predicted protein [Physcomitrella patens subsp. patens]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vh9_B7e-1941257272231A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_B9e-1619435965236A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A7e-1941257272231A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A9e-1619435965236A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwb_B9e-1941257249208A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ0402661334225530
GW5985193062765730
GW5985192071573582e-24
BQ0402661322123360.000000002
GW598519444775180.7
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.2Gorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3Pp1s353_23V6.4
Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny