Basic Information | |
---|---|
Species | Physcomitrella patens |
Cazyme ID | Pp1s270_78V6.1 |
Family | AA6 |
Protein Properties | Length: 161 Molecular Weight: 16785.3 Isoelectric Point: 10.1767 |
Chromosome | Chromosome/Scaffold: 270 Start: 534168 End: 535208 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 11 | 84 | 1.2e-27 |
TLPADVLTKVTALPKDELIPVITAAQLLEADAFLFGIPTRYGTISAQMKAFSDSTRGLWRGQSLAGKPTGIFVQ |
Full Sequence |
---|
Protein Sequence Length: 161 Download |
MAGLVPLQLS TLPADVLTKV TALPKDELIP VITAAQLLEA DAFLFGIPTR YGTISAQMKA 60 FSDSTRGLWR GQSLAGKPTG IFVQYIFQYA TLRSVELAVG AGELAASGVA AGAAEGATVG 120 GVERALLAET ERGQGFARGP GTANNQRLWA PVKTKKNRER * |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam03358 | FMN_red | 2.0e-7 | 34 | 82 | 49 | + NADPH-dependent FMN reductase. |
TIGR01755 | flav_wrbA | 1.0e-13 | 11 | 83 | 73 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
COG0655 | WrbA | 1.0e-13 | 37 | 88 | 53 | + Multimeric flavodoxin WrbA [General function prediction only] |
PRK03767 | PRK03767 | 6.0e-16 | 11 | 83 | 73 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABR16990.1 | 9e-22 | 12 | 83 | 113 | 184 | unknown [Picea sitchensis] |
GenBank | ACJ85377.1 | 3e-21 | 11 | 83 | 52 | 124 | unknown [Medicago truncatula] |
RefSeq | XP_001769382.1 | 6e-32 | 11 | 82 | 1 | 72 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_001785483.1 | 8e-35 | 11 | 83 | 144 | 216 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_002534445.1 | 5e-21 | 11 | 82 | 43 | 113 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0.0000000002 | 11 | 82 | 42 | 111 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3b6m_A | 0.0000000002 | 11 | 82 | 42 | 111 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3b6k_B | 0.0000000002 | 11 | 82 | 42 | 111 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3b6k_A | 0.0000000002 | 11 | 82 | 42 | 111 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3b6j_B | 0.0000000002 | 11 | 82 | 42 | 111 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DC937476 | 74 | 11 | 84 | 3e-35 |
BY945553 | 73 | 11 | 83 | 5e-35 |
DC914311 | 74 | 11 | 84 | 6e-35 |
DC932961 | 74 | 11 | 84 | 8e-35 |
DC935370 | 73 | 11 | 83 | 8e-35 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |