| Basic Information | |
|---|---|
| Species | Physcomitrella patens |
| Cazyme ID | Pp1s309_36V6.1 |
| Family | GH16 |
| Protein Properties | Length: 233 Molecular Weight: 26400.9 Isoelectric Point: 8.8797 |
| Chromosome | Chromosome/Scaffold: 309 Start: 189334 End: 190621 |
| Description | xyloglucan endotransglucosylase/hydrolase 9 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 3 | 150 | 3.4e-23 |
| SKRSWLYGGFGAWIQLPAGNSAGTVTTLYMTSPGPHHCELDFEFLGNQTGEPFLLHTNVFVDGVGGREQQIYLGFDPSAAFHYYNFQWNKDLIVFYVDNT PVRMFRNLEGIVPRFKYPNHQAMGLFLSIWDGSSWATQGGRVKLDWIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 233 Download |
| MGSKRSWLYG GFGAWIQLPA GNSAGTVTTL YMTSPGPHHC ELDFEFLGNQ TGEPFLLHTN 60 VFVDGVGGRE QQIYLGFDPS AAFHYYNFQW NKDLIVFYVD NTPVRMFRNL EGIVPRFKYP 120 NHQAMGLFLS IWDGSSWATQ GGRVKLDWIA APFVATYQKF RLNGCVVESY DSDGIRKCQN 180 TMWAAPGPNA QRLPTGRVRQ MRAVRQNQVK YNYCDDRKRY PSAPPECAYN VL* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00413 | Glyco_hydrolase_16 | 9.0e-17 | 4 | 161 | 166 | + glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| cd02175 | GH16_lichenase | 2.0e-18 | 9 | 150 | 154 | + lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure. | ||
| pfam00722 | Glyco_hydro_16 | 1.0e-51 | 3 | 149 | 149 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 1.0e-71 | 3 | 227 | 232 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 2.0e-126 | 1 | 227 | 228 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_001770193.1 | 0 | 1 | 232 | 4 | 234 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001772866.1 | 0 | 1 | 232 | 64 | 295 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001777007.1 | 0 | 2 | 232 | 69 | 300 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001781669.1 | 0 | 1 | 232 | 3 | 234 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001784557.1 | 0 | 1 | 232 | 65 | 297 | predicted protein [Physcomitrella patens subsp. patens] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 3 | 227 | 53 | 272 | A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole |
| PDB | 1un1_A | 0 | 3 | 227 | 53 | 272 | A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole |
| PDB | 1umz_B | 0 | 3 | 227 | 53 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 3 | 227 | 53 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 7.00649e-44 | 10 | 227 | 61 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BJ952635 | 193 | 41 | 233 | 0 |
| BJ954829 | 181 | 53 | 233 | 0 |
| BJ956838 | 178 | 56 | 233 | 0 |
| BJ958767 | 186 | 48 | 233 | 0 |
| FC445739 | 169 | 65 | 233 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Physcomitrella patens | Pp1s81_246V6.1 | Pp1s122_57V6.1 | Pp1s410_28V6.1 | Pp1s213_129V6.1 | Pp1s486_17V6.1 |
| Pp1s486_14V6.1 | Pp1s141_131V6.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |