y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhyscomitrella patens
Cazyme IDPp1s40_48V6.1
FamilyAA1
Protein PropertiesLength: 582 Molecular Weight: 65953.8 Isoelectric Point: 7.0708
ChromosomeChromosome/Scaffold: 40 Start: 397418 End: 401180
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1973463.7e-22
  ASYPGPTLEAIQNVTSHIRWENHIHDKEHMFTVDPTVMWANPKKGGVPMVVHLHGAETAAVSDGYPDAWYTAFGDTGHAYTTKDYQYPNQQSPTMLWYHD
  HTFGITRLNILSGMAGLYIIRPKEKLPAWIPHKNYEVTLFLQDKALYNDGRINFPTVGLSLRNHPHWCPEYFGDVILVNGKAWPYLVVKPRKYRFRLVNG
  GNARVFELSLSTHKTGFIQIGTDGGLLEKPMYVSSLIAAPAERLDFIIDF
Full Sequence
Protein Sequence     Length: 582     Download
MDFFRVCVLV LAWTCCLFHP RLVLADADDS NSTNSICQAM VPSPKLEMFV DKLPKLRKIS    60
FANGKKLTIG VYKIKQKLHR DLPPTTLYAY GTTARTASYP GPTLEAIQNV TSHIRWENHI    120
HDKEHMFTVD PTVMWANPKK GGVPMVVHLH GAETAAVSDG YPDAWYTAFG DTGHAYTTKD    180
YQYPNQQSPT MLWYHDHTFG ITRLNILSGM AGLYIIRPKE KLPAWIPHKN YEVTLFLQDK    240
ALYNDGRINF PTVGLSLRNH PHWCPEYFGD VILVNGKAWP YLVVKPRKYR FRLVNGGNAR    300
VFELSLSTHK TGFIQIGTDG GLLEKPMYVS SLIAAPAERL DFIIDFSLVA GEDIILKNSA    360
LVPYPDGDPA FTPPSTQSIM KFKVKKFDKD DAPNSPAIPA MLRKPDPVIS LENATWRTNT    420
MIEIADEDDF PTGSLLSNLT WMDPVTDIPY LGSTEIWEFI NLTPDAHPMH IHLIKFKVLN    480
IQPFNLTLYE EKGCHRFEHS YRGPGSCITE DPVEPKAYHA GWKDTVIALP GYITRLVLHW    540
SPEYGGEFPF DATAKPGYLW HCHILDHEDN DMMRPIQMLR R*                       600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109652.0e-9451573125+
pfam07731Cu-oxidase_28.0e-10444576145+
PRK10883PRK108838.0e-17184352186+
PRK10965PRK109651.0e-22147418283+
COG2132SufI1.0e-4391578499+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001041895.104558041582Os01g0126100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_001760041.10405811542predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001785815.10775811505predicted protein [Physcomitrella patens subsp. patens]
RefSeqZP_04150084.10465793518Multicopper oxidase, type 2 [Bacillus pseudomycoides DSM 12442]
RefSeqZP_04161675.10465793518Multicopper oxidase, type 2 [Bacillus mycoides Rock1-4]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0465783508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x88_A0465783508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2x87_A0465783508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0465783508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0465783508A Chain A, Crystal Structure Of The Reconstituted Cota
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BY95206623812380
BJ6082652093745820
BJ6008281913925820
BJ6083231913925820
BJ1710751873965820
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny