| Basic Information | |
|---|---|
| Species | Physcomitrella patens |
| Cazyme ID | Pp1s6328_2V6.1 |
| Family | GH1 |
| Protein Properties | Length: 130 Molecular Weight: 15468.3 Isoelectric Point: 6.2602 |
| Chromosome | Chromosome/Scaffold: 6328 Start: 537 End: 926 |
| Description | beta-glucosidase 45 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 5 | 128 | 0 |
| RGWEIYEKGIYDIMVNLKENYGNVESFISENGMGVQDEERFLKDGQIQDDYRIEFIEGHLQWLHKSLEEGCNVKGYHLWTFMDNWSWSNAYKNRYGFISV DIKTQQRTPKKSAYWFKNVAKNNG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 130 Download |
| MNPYRGWEIY EKGIYDIMVN LKENYGNVES FISENGMGVQ DEERFLKDGQ IQDDYRIEFI 60 EGHLQWLHKS LEEGCNVKGY HLWTFMDNWS WSNAYKNRYG FISVDIKTQQ RTPKKSAYWF 120 KNVAKNNGF* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 4.0e-26 | 7 | 127 | 122 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| PRK13511 | PRK13511 | 8.0e-39 | 7 | 126 | 121 | + 6-phospho-beta-galactosidase; Provisional | ||
| TIGR03356 | BGL | 1.0e-39 | 6 | 120 | 115 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-41 | 6 | 129 | 125 | + Glycosyl hydrolase family 1. | ||
| COG2723 | BglB | 7.0e-54 | 4 | 128 | 126 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_001786829.1 | 0 | 1 | 129 | 140 | 268 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | YP_001665910.1 | 0 | 1 | 129 | 334 | 462 | Beta-glucosidase [Thermoanaerobacter pseudethanolicus ATCC 33223] |
| RefSeq | YP_173986.1 | 0 | 1 | 129 | 334 | 462 | beta-glucosidase [Bacillus clausii KSM-K16] |
| RefSeq | ZP_05336910.1 | 0 | 1 | 129 | 334 | 462 | Beta-glucosidase [Thermoanaerobacterium thermosaccharolyticum DSM 571] |
| RefSeq | ZP_05491943.1 | 0 | 1 | 129 | 334 | 462 | glycoside hydrolase family 1 [Thermoanaerobacter ethanolicus CCSD1] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4b3l_F | 9.80909e-45 | 1 | 127 | 332 | 459 | A Chain A, Peanut Peroxidase |
| PDB | 4b3l_E | 9.80909e-45 | 1 | 127 | 332 | 459 | A Chain A, Peanut Peroxidase |
| PDB | 4b3l_D | 9.80909e-45 | 1 | 127 | 332 | 459 | A Chain A, Peanut Peroxidase |
| PDB | 4b3l_C | 9.80909e-45 | 1 | 127 | 332 | 459 | A Chain A, Peanut Peroxidase |
| PDB | 4b3l_B | 9.80909e-45 | 1 | 127 | 332 | 459 | A Chain A, Peanut Peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FG513186 | 119 | 9 | 126 | 6e-25 |
| BB922479 | 111 | 13 | 123 | 9e-25 |
| FG536440 | 111 | 13 | 123 | 2e-24 |
| CV515030 | 113 | 10 | 121 | 4e-24 |
| CV515781 | 113 | 10 | 121 | 5e-24 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |