CAZyme Information

Basic Information
SpeciesPhyscomitrella patens
Cazyme IDPp1s8_186V6.1
FamilyAA2
Protein PropertiesLength: 321 Molecular Weight: 34770.6 Isoelectric Point: 6.5074
ChromosomeChromosome/Scaffold: 8 Start: 1722076 End: 1723038
DescriptionPeroxidase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2542970
  PASLLRLSFHDCQVEKCDASILLDSVSNDINGERESGGNFGIRRLDIIDRVKQDLEKECPGVVSCADIVAMAGRDAVSYTGGPEIPIPLGRKDATTASSE
  NADDQLPPASSTVSTMLQVFSRYGMTAAETVGILGAHTLGIGHCVNVVDRLYPTRDPALSTGLYLQLRVLCPTKEPLNLTILPNDLSVYSFDNRYFKDVL
  GGRGLFRADANLVGDARTKPLVAKFASDQSLFFKTFASAYVKLV
Full Sequence
Protein Sequence     Length: 321     Download
MEWGSVLILL LLSSVILFSE GHLSSDYYKS TCPNVERVVR SSLRRAFLLD PSAPASLLRL    60
SFHDCQVEKC DASILLDSVS NDINGERESG GNFGIRRLDI IDRVKQDLEK ECPGVVSCAD    120
IVAMAGRDAV SYTGGPEIPI PLGRKDATTA SSENADDQLP PASSTVSTML QVFSRYGMTA    180
AETVGILGAH TLGIGHCVNV VDRLYPTRDP ALSTGLYLQL RVLCPTKEPL NLTILPNDLS    240
VYSFDNRYFK DVLGGRGLFR ADANLVGDAR TKPLVAKFAS DQSLFFKTFA SAYVKLVSAQ    300
VLTGSRGEVR TNCRRVNAQD * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase9.0e-3039296276+
cd00314plant_peroxidase_like1.0e-3139298290+
pfam00141peroxidase2.0e-5939281244+
PLN03030PLN030302.0e-6027317301+
cd00693secretory_peroxidase7.0e-13022316301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAA94985.101931717321peroxidase-like protein [Arabidopsis thaliana]
DDBJBAB97197.20631716329peroxidase 1 [Marchantia polymorpha]
RefSeqNP_566565.10731717339peroxidase, putative [Arabidopsis thaliana]
RefSeqXP_001753324.1013201320predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001763678.102231323312predicted protein [Physcomitrella patens subsp. patens]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0223182305A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB1pa2_A0223182305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1bgp_A0233139301A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1sch_B0223171294A Chain A, Peanut Peroxidase
PDB1sch_A0223171294A Chain A, Peanut Peroxidase
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT624617288223080
DN448978282223020
DN449410282223020
DN457526271222910
DT624332267222870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1Pp1s104_177V6.3
Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)