Basic Information | |
---|---|
Species | Sorghum bicolor |
Cazyme ID | Sb01g004580.1 |
Family | GT1 |
Protein Properties | Length: 161 Molecular Weight: 17137.4 Isoelectric Point: 4.9882 |
Chromosome | Chromosome/Scaffold: 1 Start: 3675732 End: 3676214 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 20 | 133 | 2.7e-28 |
DRTRGRGLVWPGWVPQVRVLAHAAVGAFLTHCGWGSTVEGLVLGHPLVMLPFVVDQGIIARTMAERGVGVEVARDESDGSFGRDGVAEAVRRVVVEEDGK VFASNAMKLKEALG |
Full Sequence |
---|
Protein Sequence Length: 161 Download |
MSAPGTDDGV GELLPAGFED RTRGRGLVWP GWVPQVRVLA HAAVGAFLTH CGWGSTVEGL 60 VLGHPLVMLP FVVDQGIIAR TMAERGVGVE VARDESDGSF GRDGVAEAVR RVVVEEDGKV 120 FASNAMKLKE ALGDQRRQDQ YMDDLVGYLT RYKGQGALGN * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN00414 | PLN00414 | 1.0e-22 | 4 | 96 | 94 | + glycosyltransferase family protein | ||
PLN02208 | PLN02208 | 4.0e-24 | 4 | 152 | 152 | + glycosyltransferase family protein | ||
PLN02863 | PLN02863 | 6.0e-25 | 4 | 91 | 89 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
PLN00164 | PLN00164 | 4.0e-28 | 6 | 100 | 96 | + glucosyltransferase; Provisional | ||
PLN02670 | PLN02670 | 9.0e-40 | 4 | 150 | 147 | + transferase, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EAZ28971.1 | 0 | 12 | 149 | 325 | 463 | hypothetical protein OsJ_13015 [Oryza sativa Japonica Group] |
RefSeq | NP_001051624.1 | 0 | 12 | 149 | 342 | 480 | Os03g0804900 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002463702.1 | 0 | 1 | 153 | 330 | 482 | hypothetical protein SORBIDRAFT_01g004560 [Sorghum bicolor] |
RefSeq | XP_002463705.1 | 0 | 1 | 160 | 332 | 491 | hypothetical protein SORBIDRAFT_01g004570 [Sorghum bicolor] |
RefSeq | XP_002463706.1 | 0 | 1 | 160 | 1 | 160 | hypothetical protein SORBIDRAFT_01g004580 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c9z_A | 2e-19 | 14 | 153 | 315 | 454 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c1z_A | 2e-19 | 14 | 153 | 315 | 454 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
alkane oxidation | RXN-4444 | - | long-chain fatty alcohol oxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE644959 | 153 | 1 | 153 | 0 |
FL751599 | 153 | 1 | 153 | 0 |
CX616312 | 153 | 1 | 153 | 0 |
HX194437 | 143 | 13 | 155 | 0 |
HX145992 | 141 | 13 | 153 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|