| Basic Information | |
|---|---|
| Species | Sorghum bicolor |
| Cazyme ID | Sb01g004580.1 |
| Family | GT1 |
| Protein Properties | Length: 161 Molecular Weight: 17137.4 Isoelectric Point: 4.9882 |
| Chromosome | Chromosome/Scaffold: 1 Start: 3675732 End: 3676214 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 20 | 133 | 2.7e-28 |
| DRTRGRGLVWPGWVPQVRVLAHAAVGAFLTHCGWGSTVEGLVLGHPLVMLPFVVDQGIIARTMAERGVGVEVARDESDGSFGRDGVAEAVRRVVVEEDGK VFASNAMKLKEALG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 161 Download |
| MSAPGTDDGV GELLPAGFED RTRGRGLVWP GWVPQVRVLA HAAVGAFLTH CGWGSTVEGL 60 VLGHPLVMLP FVVDQGIIAR TMAERGVGVE VARDESDGSF GRDGVAEAVR RVVVEEDGKV 120 FASNAMKLKE ALGDQRRQDQ YMDDLVGYLT RYKGQGALGN * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN00414 | PLN00414 | 1.0e-22 | 4 | 96 | 94 | + glycosyltransferase family protein | ||
| PLN02208 | PLN02208 | 4.0e-24 | 4 | 152 | 152 | + glycosyltransferase family protein | ||
| PLN02863 | PLN02863 | 6.0e-25 | 4 | 91 | 89 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
| PLN00164 | PLN00164 | 4.0e-28 | 6 | 100 | 96 | + glucosyltransferase; Provisional | ||
| PLN02670 | PLN02670 | 9.0e-40 | 4 | 150 | 147 | + transferase, transferring glycosyl groups | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAZ28971.1 | 0 | 12 | 149 | 325 | 463 | hypothetical protein OsJ_13015 [Oryza sativa Japonica Group] |
| RefSeq | NP_001051624.1 | 0 | 12 | 149 | 342 | 480 | Os03g0804900 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002463702.1 | 0 | 1 | 153 | 330 | 482 | hypothetical protein SORBIDRAFT_01g004560 [Sorghum bicolor] |
| RefSeq | XP_002463705.1 | 0 | 1 | 160 | 332 | 491 | hypothetical protein SORBIDRAFT_01g004570 [Sorghum bicolor] |
| RefSeq | XP_002463706.1 | 0 | 1 | 160 | 1 | 160 | hypothetical protein SORBIDRAFT_01g004580 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vch_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vce_A | 5e-22 | 13 | 131 | 327 | 445 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c9z_A | 2e-19 | 14 | 153 | 315 | 454 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c1z_A | 2e-19 | 14 | 153 | 315 | 454 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| alkane oxidation | RXN-4444 | - | long-chain fatty alcohol oxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FE644959 | 153 | 1 | 153 | 0 |
| FL751599 | 153 | 1 | 153 | 0 |
| CX616312 | 153 | 1 | 153 | 0 |
| HX194437 | 143 | 13 | 155 | 0 |
| HX145992 | 141 | 13 | 153 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
