y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb01g015590.1
FamilyGT77
Protein PropertiesLength: 616 Molecular Weight: 70035.6 Isoelectric Point: 6.8955
ChromosomeChromosome/Scaffold: 1 Start: 15179650 End: 15185056
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771303530
  VDNLLVGAMDTKLLRELYFRGVPVFDMGSRMATEDAGWGSPTFHKMGREKVLLINALLPFGYELLMCDTDMVWLKNPLPYLARYPDADLLTSSDQVIPTV
  TDDSLENWREVTGAFNIGIFHWRPTEPAKRLAKDWKDLVISDDKLWDQNAFNDLVRKNFGQPVQGGDLVYSYDGKLKLGVLPASIFCSGHTYFVQGMYKQ
  LHLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 616     Download
MAAWCSAEST KPVFVGIYGA VLGGFAVSAL FFLLSSFSTL SAPTLPLPAA AIAGANLSAP    60
TPAQPETMYN RPIWKPPPRR ARMPSPRAFR LTRDMVAARA RDGVIVVTFG NYAFLDFILT    120
WVRHLTDLGV DNLLVGAMDT KLLRELYFRG VPVFDMGSRM ATEDAGWGSP TFHKMGREKV    180
LLINALLPFG YELLMCDTDM VWLKNPLPYL ARYPDADLLT SSDQVIPTVT DDSLENWREV    240
TGAFNIGIFH WRPTEPAKRL AKDWKDLVIS DDKLWDQNAF NDLVRKNFGQ PVQGGDLVYS    300
YDGKLKLGVL PASIFCSGHT YFVQGMYKQL HLEPYAVHTT FQYAGTEGKR HRLREAMLFF    360
DQPSYYDSPG GFLSFKPNIP KSLLLDGAHT VESHFELVNY QLKQIRTALA VASLLKRTLV    420
MPPLWCRLDR MWFGHPGILE GTMTRQPFLC PMDHVFEVHV MLKDLPKEEF GPHIDFREYS    480
FLENPSLPKE VKDSLLDVQL CDEHSSRCSA VDETDKHRPF LLPRNSTEEK LLDLLSPYKD    540
VKIIQFSSMV DAFGGFADAA VEKKFRNRVK RYVGLWCCVE FRDIGHIYYD MYWDEKPGWK    600
PHPPETREQD HPPWS*                                                    660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans9.0e-46130353230+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF97349.1016141617expressed protein [Oryza sativa (japonica cultivar-group)]
GenBankEEC75649.1016141617hypothetical protein OsI_12401 [Oryza sativa Indica Group]
GenBankEEE59420.1013361471553hypothetical protein OsJ_11574 [Oryza sativa Japonica Group]
RefSeqNP_001143144.1016151615hypothetical protein LOC100275624 [Zea mays]
RefSeqXP_002464281.1016151615hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1308722951734660
DT5119933021044040
EV2351133031684690
GR7084012981164120
CA2591882343706030
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)