CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb01g019470.1
FamilyAA3
Protein PropertiesLength: 775 Molecular Weight: 83917.6 Isoelectric Point: 7.848
ChromosomeChromosome/Scaffold: 1 Start: 20915474 End: 20926233
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32617641.12104e-44
  RCDVVIVGSGCGGGVAAAVLASAGHKVVVIEKGDYFTAEDYSSVEGPSMERLYEKGGIFCTTNVTTILFTGTTVGGGSAINWSASIRTPEEVRQEWAREH
  GLPVFASPGYVQAMDAVCARLAVTDGCRDEGFQNKVVRRGCEALALRADAVPRNSSEDHFCGSCYIGCPTGEKRGTDTTWLVDAVARGAVILTGCKAERF
  ILESNSNSSSGRKGRKCVGVVARCMSNGITKELRIEAKVSISGCGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQAQITGKCFEGGIITS
  MHRVTERTIIETPALGPGCFASLMPWESGRDMKERMRRYARTAHAFALVRDRGAGTVDGEGRVRYTPNRADAEELRNGLRRALRILVAAGAAEVGTHRSD
  GFGLRCNGGVRDDELEAFLDEVTVAEGPMRPGPDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSK
  GIAE
Full Sequence
Protein Sequence     Length: 775     Download
MAAQEEAKAA TRRRRRGHPL LRGCRRERYT HGLHLAQMEA LRAMCGALIP SLPLPPVTER    60
SLHGDSSDGG ERKDLERFYL ASAADGTIPE EVAELVTRCV WEAVVLVNVV LWILSTKVGT    120
LALCGRLCIS GGKFPYVRKF ADMPVERREQ ALTQWNRTRW LFPLKITFVV VKILSHYAFY    180
TTINENSDDN PSWKAIGYSV PHGEEETRED ETEAAPSPRP LDNGIVETKA LDDTALLTSL    240
MARGLEVKPA APPANAYHTV RCDVVIVGSG CGGGVAAAVL ASAGHKVVVI EKGDYFTAED    300
YSSVEGPSME RLYEKGGIFC TTNVTTILFT GTTVGGGSAI NWSASIRTPE EVRQEWAREH    360
GLPVFASPGY VQAMDAVCAR LAVTDGCRDE GFQNKVVRRG CEALALRADA VPRNSSEDHF    420
CGSCYIGCPT GEKRGTDTTW LVDAVARGAV ILTGCKAERF ILESNSNSSS GRKGRKCVGV    480
VARCMSNGIT KELRIEAKVS ISGCGALMTP PLLRNSGLKN RHIGRNLHLH PVSMAWGYFP    540
ENKQQAQITG KCFEGGIITS MHRVTERTII ETPALGPGCF ASLMPWESGR DMKERMRRYA    600
RTAHAFALVR DRGAGTVDGE GRVRYTPNRA DAEELRNGLR RALRILVAAG AAEVGTHRSD    660
GFGLRCNGGV RDDELEAFLD EVTVAEGPMR PGPDKWALHC SAHQMGSCRM GSSPKDGAVD    720
GRGESWEAEG LYVCDGSLLP TAVGVNPMIT IQSIAFCLSK GIAETLAHGK DKGQ*         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03970Rv06978.0e-666675594+
pfam05199GMC_oxred_C3.0e-21622755134+
COG2303BetA1.0e-25331756475+
pfam00732GMC_oxred_N2.0e-85309532227+
Gene Ontology
GO TermDescription
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR36691.10677424783unknown [Zea mays]
DDBJBAH94933.101676810760Os10g0474966 [Oryza sativa Japonica Group]
RefSeqNP_001142399.10957741675hypothetical protein LOC100274574 [Zea mays]
RefSeqXP_002464495.1017741774hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
RefSeqXP_002464496.10387741732hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ljp_B0.0001451754226518A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant
PDB3ljp_A0.0001451754226518A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant
PDB3nne_H0.0003451754226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0003451754226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.0003451754226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794753738367660
DV5204962913196080
EG4003592814787580
DV8565212824887690
CK2089133563266810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)