CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb01g021960.1
FamilyCE10
Protein PropertiesLength: 775 Molecular Weight: 84748 Isoelectric Point: 6.1279
ChromosomeChromosome/Scaffold: 1 Start: 26685805 End: 26691115
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105317514.4e-30
  CKDSSHSPTVVILHGGPHSVSVSSYSRSSAFLASLGFNLLIINYRGTPGYGEEALQSLPGKVGSQDVQDCLTALDFTIKEELVDASKVAVVGISHGGFLT
  THLIGQAPDRFVVAAARNPVCNLSLMIGTTDIPDWCYIVACGTEAKQYASEAPSSNHLHLFYQKSPIAHISKVKAPLLMLLGGADLRVPASNGLQYARGL
  RERGGEVKIMMFPEDIHEINL
Full Sequence
Protein Sequence     Length: 775     Download
MSWEKENPLR MDAMTSEEYA SQSKLLQEFT NVPSIDSALI LKTNNEDRST AMFSVSQPDL    60
LANSNRKYIL YSHITRAGTN SLDFQWSPFP TEITGVSVIV PSPSGSKLLV VRNGEKDCPT    120
KLEIVYQSHV EKEIHVVKSM HGPLYTDEWF HGISWNQEET LIAYIAEAPT QPKPAFNHSG    180
FRKEGSSEAD CNTWKGQGDW EENWGERYSN KGRPSLFVLD IARGQVRAAK GISTSLSVGQ    240
VVWAPASSSG SQKYLVFVGW LEHNGFQNTA RKLGIKYCSN RPCALYAIPC PFEGSEPDST    300
PASDGKSDSS IVARNLTTGF SSALFPRFSR DGKLLVFLSS KQAVDSGAHN ATDSLHIINW    360
PSEWKMDKQL DVNEMVPIVM CPEDGCFPGL YCSSMLSDPW LPDGCTMILT SAWRSTEVIL    420
SIDVLSGKVT RITPEDSYYS WSALALDGNN VLAVSSSPID PPYIRYGHPV TPEGQGWTWD    480
EVTSPLMASN SKVKSLLLHH SVSILKIPVP SPSNDLSDGG KLPFEAIFVS CKDSSHSPTV    540
VILHGGPHSV SVSSYSRSSA FLASLGFNLL IINYRGTPGY GEEALQSLPG KVGSQDVQDC    600
LTALDFTIKE ELVDASKVAV VGISHGGFLT THLIGQAPDR FVVAAARNPV CNLSLMIGTT    660
DIPDWCYIVA CGTEAKQYAS EAPSSNHLHL FYQKSPIAHI SKVKAPLLML LGGADLRVPA    720
SNGLQYARGL RERGGEVKIM MFPEDIHEIN LPRSDFESFL NIGVWFKKHL NAVA*         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12695Abhydrolase_56.0e-5539732194+
pfam12697Abhydrolase_61.0e-6540743204+
COG0657Aes2.0e-7518770279+
pfam00326Peptidase_S96.0e-31566772210+
COG1506DAP29.0e-41308770466+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47614.10117741767prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEAY78482.10117741796hypothetical protein OsI_33574 [Oryza sativa Indica Group]
RefSeqNP_001064603.1037743777Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147818.10117741783LOC100281428 [Zea mays]
RefSeqXP_002467246.1017741774hypothetical protein SORBIDRAFT_01g021960 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B8e-20530747371578A Chain A, Structure Of Chitinase, Chic, From Aspergillus Fumigatus.
PDB4hxe_B8e-20530747371578B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L2e-19530747371578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K2e-19530747371578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J2e-19530747371578A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA1195852564667190
CA2898762251353590
GO8504863404317680
CA0698342332875170
GO8504843354317630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021970.3
Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)