CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb01g021970.2
FamilyCE10
Protein PropertiesLength: 771 Molecular Weight: 84633.9 Isoelectric Point: 5.7842
ChromosomeChromosome/Scaffold: 1 Start: 26691424 End: 26712447
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105327534.9e-32
  SASNPTIVVLHGGPHSVYPSSYSKSLAFLFSQGYNLLVVNYRGSLGFGEEALQSLPGNIGSQDVNDVLTALDLVIKRGLIDPSRVAVVGGSHGGFLTTHL
  IGQAPDTFVAAAARNPVCNLSLMVGTSDIPDWCFVEIYGKEGKKYFSESPSVDDICQFHQKSPISHISEVKTPTLFLLGAQDLRVPVSNGLQYARALKER
  GIESKTIIFPEDIHGIDKPQSD
Full Sequence
Protein Sequence     Length: 771     Download
MATTQASDAA ADKGLPLAVD ATMADEYASQ SKLLQEFVKI PTIGKAWIFN SKDDDMSKAV    60
VSIGQTDLLA NKRRQFLLNS HISKSPKSVD FKWSPFPTEI SGASAVIPSP SGEKLLLVRN    120
SEDDSPTKLE IWGPCQLENE IHIAKSVHGS LYTDEWFGGI SWNQEETFIA YVAEEPPQPK    180
PVFNDYGFKK EGSSEKDCKS WKGQGDWEET WGETYSKKRI PALFVVNISS GEVRPVKQIP    240
RSLSVGQVIW APSSSYSLVF VAWSSDNGFQ ETPRKLGIKY CYNRPCALYA APDPFREEAE    300
KSSTEGNKSE TTTMIKLTGD LISAFFPRFS PDGKYLVFIS AKSAVDSGAH NATNSMHRIE    360
WPADGNLDGS LGIVAVVMCP KDNCFPGLYC FGLLRDPWLT DGQTMIISSV WGSREVILSV    420
NVVSCEVSRV SPQDSDYSWN VLAVDKNNIL AVSSSLITLP QMYYAIKVPQ TESNWEWQEV    480
STPFPKPSDK ISSILAEHKF SILKIPISNP SDKLANGAKL PFEAIFVSHK DSASNPTIVV    540
LHGGPHSVYP SSYSKSLAFL FSQGYNLLVV NYRGSLGFGE EALQSLPGNI GSQDVNDVLT    600
ALDLVIKRGL IDPSRVAVVG GSHGGFLTTH LIGQAPDTFV AAAARNPVCN LSLMVGTSDI    660
PDWCFVEIYG KEGKKYFSES PSVDDICQFH QKSPISHISE VKTPTLFLLG AQDLRVPVSN    720
GLQYARALKE RGIESKTIIF PEDIHGIDKP QSDFESFLNI GVWFKKHMSK *             780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12697Abhydrolase_63.0e-11538741204+
COG0657Aes2.0e-11516769275+
COG1505COG15052.0e-12515732228+
pfam00326Peptidase_S99.0e-37552770226+
COG1506DAP29.0e-50315770460+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47613.10177065839prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABB47614.10197691764prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064602.1017701775Os10g0415600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064603.10127694774Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151758.1017701774LOC100285393 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B2e-20530746373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxe_B2e-20530746373579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L4e-20530746373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K4e-20530746373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J4e-20530746373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8504863404297660
GO8504843354297610
JG8943692833806620
GO8725903231144330
JG9230542804447230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.1Sb01g021970.5Sb01g021960.1Sb01g021970.3
Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)