y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb01g042410.1
FamilyCE11
Protein PropertiesLength: 338 Molecular Weight: 36242 Isoelectric Point: 5.5824
ChromosomeChromosome/Scaffold: 1 Start: 65674674 End: 65681953
DescriptionUDP-3-O-acyl N-acetylglycosamine deacetylase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE11263100
  QQTLAAAVSRSGVGLHSGARVTATLFPTQAGEGRYFLVEGEEEAKVAAEVGNAEPRSQLCTTLRRGEGAHTRVRTVEHLLSAMEALGVDNCRIEVSGGDE
  IPLLDGSAQEWVEAIQSVGLCAAEDANGLKLDKLAPEIHEPVYLGKDDCFIAAFPSSQIHITYGIDFPKVPTIGCQWVSTFLDENIYSSKIAPARTFCIF
  EEVEKMRAAGLIKGGSLENAMVCSISGGWLNPPLRFEDEPCRHKILDLIGDFSLFAQNGNQGFPIAHIIAYKAGHALHTDFLSHL
Full Sequence
Protein Sequence     Length: 338     Download
MSSAAARALT SVSRAAFSWK PTGRPQQTLA AAVSRSGVGL HSGARVTATL FPTQAGEGRY    60
FLVEGEEEAK VAAEVGNAEP RSQLCTTLRR GEGAHTRVRT VEHLLSAMEA LGVDNCRIEV    120
SGGDEIPLLD GSAQEWVEAI QSVGLCAAED ANGLKLDKLA PEIHEPVYLG KDDCFIAAFP    180
SSQIHITYGI DFPKVPTIGC QWVSTFLDEN IYSSKIAPAR TFCIFEEVEK MRAAGLIKGG    240
SLENAMVCSI SGGWLNPPLR FEDEPCRHKI LDLIGDFSLF AQNGNQGFPI AHIIAYKAGH    300
ALHTDFLSHL SGKNTVDQEQ LAGQCSNICG SYSSYVR*                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13188PRK131886.0e-6226306307+
TIGR00325lpxC4.0e-7426307283+
pfam03331LpxC6.0e-9026307283+
COG0774LpxC7.0e-9226307286+
PRK13186lpxC6.0e-10726310287+
Gene Ontology
GO TermDescription
GO:0008759UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN52736.1013251315Hypothetical protein [Oryza sativa Japonica Group]
GenBankABF94722.1012841280UDP-3-0-acyl N-acetylglucosamine deacetylase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEE58623.1013251322hypothetical protein OsJ_09977 [Oryza sativa Japonica Group]
RefSeqNP_001049426.1013251321Os03g0223900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002468246.1013371337hypothetical protein SORBIDRAFT_01g042410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4fw7_D4e-36263107277A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB4fw7_C4e-36263107277A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB4fw7_B4e-36263107277A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB4fw7_A4e-36263107277A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
PDB4fw6_D4e-36263107277A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose.
Metabolic Pathways
Pathway NameReactionECProtein Name
lipid IVA biosynthesisUDPACYLGLCNACDEACETYL-RXNEC-3.5.1.108UDP-3-O-acyl-N-acetylglucosamine deacetylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA2465592161223370
HX13680526072660
CT85007229912990
CK20717725072560
CA2383821871223080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00088.3Aquca_091_00088.2Aquca_091_00088.1
Arabidopsis lyrata472870
Arabidopsis thalianaAT1G25054.1AT1G24793.2AT1G25210.2AT1G24793.1AT1G24880.1
AT1G25054.2AT1G25145.1AT1G25210.1
Brachypodium distachyonBradi1g69490.1
Brassica rapaBra010979
Carica papayaevm.model.supercontig_2.193
Capsella rubellaCarubv10009664m
Chlamydomonas reinhardtiiCre16.g653350.t1.2
Citrus clementinaCiclev10015996mCiclev10015964m
Citrus sinensisorange1.1g042138m
Cucumis sativusCucsa.188640.1Cucsa.188650.1
Eucalyptus grandisEucgr.B02675.2Eucgr.B02675.1
Glycine maxGlyma02g09350.1
Gossypium raimondiiGorai.002G172000.4Gorai.002G172000.5Gorai.002G172000.3Gorai.002G172000.1Gorai.002G172000.2
Gorai.002G172000.6Gorai.001G151600.1Gorai.010G050600.1Gorai.005G149500.1Gorai.005G145500.1
Gorai.009G391300.3Gorai.009G391300.2Gorai.009G391300.1Gorai.007G245600.1
Linum usitatissimumLus10003708Lus10001592
Malus domesticaMDP0000319902MDP0000264715MDP0000150490
Manihot esculentacassava4.1_012733m
Mimulus guttatusmgv1a025203m
Oryza sativaLOC_Os03g12320.3LOC_Os03g12320.2LOC_Os03g12320.1
Panicum virgatumPavirv00014435mPavirv00025226m
Physcomitrella patensPp1s1_376V6.1
Phaseolus vulgarisPhvul.003G019200.2Phvul.003G019200.1
Picea abiesMA_159099g0220MA_10433938g0010
Populus trichocarpaPotri.010G106400.1Potri.010G106400.2Potri.T177300.1Potri.010G106400.3
Prunus persicappa009014m
Ricinus communis29673.m000948
Setaria italicaSi036592mSi010565mSi036620m
Selaginella moellendorffii117127
Thellungiella halophilaThhalv10007963m
Vitis viniferaGSVIVT01011660001
Volvox carteriVocar20012425m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny