y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb02g028740.1
FamilyCE8
Protein PropertiesLength: 320 Molecular Weight: 34423.8 Isoelectric Point: 5.9625
ChromosomeChromosome/Scaffold: 2 Start: 63894544 End: 63895607
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE873040
  DVVVAADGSGDYSSVSAAIAAAPLKSNKRHVIHIKKGLYKEFVILGEDAWNVTLIGDGMDATVISGSRCCADGFHTPQTAVLTVLGRGFIARDLRVENTA
  GPRKELGQAVALLSNSDQSVVFRCALRGYQDTLYAELGRQFYRECKISGTVDFIFGDAAAVFQNCDILARLPIQGQQNTLTAEGRDKPDSNGGFCFQSCT
  VAADDDLAKASGVETYLGRPWKAYSRVIFMKSTISNVRHAKGWLPWEHAAPPDTIYYAEYDNDGPGAAVGGRVKWSGFHTIQDAAEAINFTVEKFING
Full Sequence
Protein Sequence     Length: 320     Download
MATVPVDVVV AADGSGDYSS VSAAIAAAPL KSNKRHVIHI KKGLYKEFVI LGEDAWNVTL    60
IGDGMDATVI SGSRCCADGF HTPQTAVLTV LGRGFIARDL RVENTAGPRK ELGQAVALLS    120
NSDQSVVFRC ALRGYQDTLY AELGRQFYRE CKISGTVDFI FGDAAAVFQN CDILARLPIQ    180
GQQNTLTAEG RDKPDSNGGF CFQSCTVAAD DDLAKASGVE TYLGRPWKAY SRVIFMKSTI    240
SNVRHAKGWL PWEHAAPPDT IYYAEYDNDG PGAAVGGRVK WSGFHTIQDA AEAINFTVEK    300
FINGNDWLPG TGVDYKPGL*                                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02301PLN023011.0e-12114319307+
PLN02314PLN023142.0e-12214315303+
PLN02468PLN024688.0e-12614319306+
PLN02201PLN022011.0e-13314319307+
pfam01095Pectinesterase7.0e-15414305293+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK92470.104319212526unknown [Populus trichocarpa]
GenBankEAZ07184.104319231558hypothetical protein OsI_29430 [Oryza sativa Indica Group]
RefSeqNP_001061940.104319231555Os08g0450100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002326321.104319204518predicted protein [Populus trichocarpa]
RefSeqXP_002462596.1013191319hypothetical protein SORBIDRAFT_02g028740 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A073194315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A023193319A Chain A, Pectin Methylesterase From Carrot
PDB3uw0_A3e-23728232345A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB1qjv_B5e-221830918339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A5e-221830918339A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX673765287323150
DT605043272383080
DY361529278423190
EH691610278162930
EH695820276443190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_033_00002.1Aquca_011_00390.1
Carica papayaevm.model.supercontig_116.69evm.model.supercontig_116.68
Capsella rubellaCarubv10003619m
Citrus clementinaCiclev10003835mCiclev10003723mCiclev10003299m
Citrus sinensisorange1.1g042946m
Fragaria vescamrna00944.1-v1.0-hybridmrna30095.1-v1.0-hybrid
Malus domesticaMDP0000217465MDP0000151159MDP0000258482MDP0000139083
Manihot esculentacassava4.1_022889mcassava4.1_021757mcassava4.1_022356m
Panicum virgatumPavirv00005884mPavirv00056856mPavirv00010344m
Prunus persicappa014833m
Setaria italicaSi015000mSi004506mSi033284m
Selaginella moellendorffii431592
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny