CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb02g029620.1
FamilyGH1
Protein PropertiesLength: 453 Molecular Weight: 51242.6 Isoelectric Point: 6.9309
ChromosomeChromosome/Scaffold: 2 Start: 64714156 End: 64718422
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1704380
  DGRGAVNPKGLEYYNNLIDELLSYGIQPHVTIYHFDFPQALQDEYNGLISRKFIEDFTAYADVCFKNFGNRVKYWTTVNEPNIETVGGYDEGILPPRRCS
  SPFGFPCNGGNSTTEPYIAAHHLLLAHASAVSLYREKYQFEPATQTPDDAAAAERMKEFHIGWFMHPIVYGDYPPVMQKNVGPRLPSFTDEERKKVKGSF
  DFVGFNHYIVVHVRADLNRLKQKLRDYMGDAAVKFDSNQFPIRLNSLTIDFKTSKPWALKKLLRHIRVKYKNPPVMIHENGAADRPDPSGGNSYDDEFRS
  QFLQDYIEATLESIRDGSNVRGYFVWSFLDMFEFLFGYRLRFGLYGVDFSSSARTRYQRHSARWYSSFL
Full Sequence
Protein Sequence     Length: 453     Download
MAAKTTHSYD AALLFLLAGV LAAAPAASIT RSDFPAGFVF GAGSSAYQVE GAFAEDGRNA    60
SIWDTFTHED GRGAVNPKGL EYYNNLIDEL LSYGIQPHVT IYHFDFPQAL QDEYNGLISR    120
KFIEDFTAYA DVCFKNFGNR VKYWTTVNEP NIETVGGYDE GILPPRRCSS PFGFPCNGGN    180
STTEPYIAAH HLLLAHASAV SLYREKYQFE PATQTPDDAA AAERMKEFHI GWFMHPIVYG    240
DYPPVMQKNV GPRLPSFTDE ERKKVKGSFD FVGFNHYIVV HVRADLNRLK QKLRDYMGDA    300
AVKFDSNQFP IRLNSLTIDF KTSKPWALKK LLRHIRVKYK NPPVMIHENG AADRPDPSGG    360
NSYDDEFRSQ FLQDYIEATL ESIRDGSNVR GYFVWSFLDM FEFLFGYRLR FGLYGVDFSS    420
SARTRYQRHS ARWYSSFLHG GELRPVALLD RA* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL2.0e-8735434463+
pfam00232Glyco_hydro_16.0e-11234437465+
PLN02814PLN028142.0e-12228440472+
PLN02849PLN028497.0e-13430440470+
PLN02998PLN029984.0e-13630440470+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACR38197.102945243530unknown [Zea mays]
Swiss-ProtB7F7K702944530510BGL31_ORYSJ RecName: Full=Beta-glucosidase 31; Short=Os9bglu31; Flags: Precursor
GenBankEEC84871.102944530510hypothetical protein OsI_32014 [Oryza sativa Indica Group]
RefSeqNP_001063638.102944530510Os09g0511600 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002462652.1014521452hypothetical protein SORBIDRAFT_02g029620 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A0204383486A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3gnp_A0204383486A Chain A, Arabidopsis Thaliana Peroxidase N
PDB3gno_A0204383486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B02943815479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A02943815479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Transmembrane Domains
StartEnd
1330
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO792897310803670
GO858337294703410
FL9921512352244520
GD0489082352244520
JG9416512352244520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00732.1Aquca_015_00033.2Aquca_015_00033.1Aquca_003_00738.1Aquca_003_00734.1
Aquca_018_00002.1Aquca_003_00738.2Aquca_003_00736.1Aquca_003_00738.4Aquca_003_00738.3
Aquca_003_00738.5Aquca_003_00733.2Aquca_003_00733.1Aquca_003_00735.1Aquca_003_00735.2
Aquca_003_00731.1Aquca_003_00734.3Aquca_003_00730.1Aquca_003_00734.2Aquca_003_00735.3
Aquca_003_00733.3Aquca_029_00030.1Aquca_003_00732.2Aquca_015_00029.1Aquca_029_00032.2
Aquca_015_00035.1Aquca_003_00738.7Aquca_015_00034.1Aquca_029_00032.1Aquca_003_00738.6
Aquca_003_00733.4Aquca_003_00734.5Aquca_003_00734.4Aquca_007_00054.1Aquca_003_00738.8
Aquca_003_00738.9Aquca_003_00738.11Aquca_003_00738.10Aquca_035_00146.2Aquca_035_00146.1
Aquca_015_00035.3Aquca_003_00738.12Aquca_015_00033.3Aquca_015_00035.4Aquca_015_00034.2
Aquca_015_00035.2Aquca_003_00738.13Aquca_007_00054.2Aquca_003_00738.15Aquca_003_00738.14
Aquca_003_00733.5Aquca_035_00146.3Aquca_015_00030.1Aquca_003_00735.4
Arabidopsis lyrata491999314159486775878433907850
326101315311486774492664315321
875932
Arabidopsis thalianaAT1G02850.2AT1G02850.5AT4G27830.1AT1G02850.4AT1G02850.3
AT1G02850.1AT4G22100.1AT4G27820.1AT1G45191.2AT1G45191.1
AT1G60090.1AT3G62750.1AT3G62740.1AT1G60260.1AT1G60270.1
AT5G16580.1
Brachypodium distachyonBradi2g59650.1Bradi2g27770.1Bradi3g45627.1Bradi2g59660.1Bradi3g45650.1
Bradi3g45640.1Bradi4g34927.1Bradi4g34950.1Bradi4g34940.1Bradi4g34940.3
Bradi2g09200.1Bradi3g45607.1Bradi4g34940.4Bradi2g09187.1Bradi4g34940.2
Brassica rapaBra033352Bra007699Bra000461.210.665Bra007698Bra034697
Bra014395Bra006755Bra015094Bra021441Bra006756
Bra013234Bra030064Bra015096
Carica papayaevm.TU.contig_25278.3evm.model.supercontig_9.230
Capsella rubellaCarubv10004624mCarubv10007006mCarubv10013516mCarubv10008974mCarubv10011227m
Carubv10017050mCarubv10018691mCarubv10017328m
Citrus clementinaCiclev10019719mCiclev10019788mCiclev10029910mCiclev10028386mCiclev10020433m
Ciclev10020639mCiclev10020770m
Citrus sinensisorange1.1g012181morange1.1g015605morange1.1g015785morange1.1g046009morange1.1g018009m
orange1.1g017505morange1.1g024821morange1.1g020989morange1.1g013298m.26.240orange1.1g013298m.26.240
Cucumis sativusCucsa.097180.1Cucsa.336940.1Cucsa.336950.1
Eucalyptus grandisEucgr.J00646.1Eucgr.J00645.2Eucgr.J00645.1Eucgr.K03473.1Eucgr.J00648.1
Eucgr.J00645.3Eucgr.J00647.1
Fragaria vescamrna03448.1-v1.0-hybridmrna03449.1-v1.0-hybrid
Glycine maxGlyma02g02230.3Glyma14g39230.1Glyma16g19480.1Glyma07g18410.1Glyma07g18400.1
Glyma02g02230.4Glyma02g17490.2Glyma14g39230.2Glyma02g02230.2
Gossypium raimondiiGorai.009G076100.2Gorai.009G076100.1
Linum usitatissimumLus10007871Lus10007872
Malus domesticaMDP0000212560MDP0000135510MDP0000938307
Manihot esculentacassava4.1_032290mcassava4.1_005780mcassava4.1_006332mcassava4.1_022817m
Medicago truncatulaMedtr5g068740.1Medtr1g088610.1Medtr4g016920.1Medtr1g088630.2Medtr1g088630.1
Medtr1g088630.3Medtr1g088630.4Medtr1g088630.5Medtr1g088630.6
Mimulus guttatusmgv1a007433m
Oryza sativaLOC_Os09g33680.1LOC_Os05g30350.1LOC_Os05g30280.3LOC_Os05g30250.1LOC_Os01g59819.1
LOC_Os01g59840.1LOC_Os01g70520.1LOC_Os09g33690.2LOC_Os05g30350.2LOC_Os05g30300.1
LOC_Os09g33710.1LOC_Os05g30280.1LOC_Os09g33680.2LOC_Os01g70520.2LOC_Os09g33690.1
LOC_Os05g30390.1LOC_Os09g33690.4LOC_Os05g30250.2LOC_Os09g33690.3
Panicum virgatumPavirv00030236mPavirv00034053mPavirv00007719mPavirv00011930mPavirv00060992m
Pavirv00043199mPavirv00052823mPavirv00060993mPavirv00000833mPavirv00012938m
Pavirv00034054mPavirv00034055mPavirv00000834mPavirv00004602mPavirv00000835m
Phaseolus vulgarisPhvul.007G145900.1Phvul.008G097600.1Phvul.008G097700.1Phvul.008G097200.1Phvul.008G097000.1
Phvul.008G097100.1Phvul.008G097100.3Phvul.008G097100.2Phvul.008G097300.1
Picea abiesMA_10434198g0010.219.693MA_10434198g0010.219.693MA_139193g0010MA_10436515g0030MA_12813g0010
Prunus persicappa004484mppa006167mppa019582mppa015330m
Ricinus communis29986.m00160629986.m00160129986.m00160329986.m00160229986.m001604
Setaria italicaSi021753mSi021785mSi001092mSi013564mSi032721m
Si013822mSi029509mSi001840mSi002332m
Sorghum bicolorSb02g029640.4Sb02g029640.3Sb02g029640.2Sb03g037780.1Sb09g018160.1
Sb09g018180.2Sb09g018180.1Sb02g029640.1Sb10g022300.1
Thellungiella halophilaThhalv10005908mThhalv10024994mThhalv10004056mThhalv10002493mThhalv10028552m
Thhalv10002501mThhalv10006510mThhalv10004297mThhalv10003058mThhalv10006515m
Vitis viniferaGSVIVT01028006001.499.961GSVIVT01028006001.499.961GSVIVT01028004001.196.654GSVIVT01028004001.196.654GSVIVT01028004001.196.654
GSVIVT01028006001.29.484GSVIVT01028006001.29.484GSVIVT01028001001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)