Basic Information | |
---|---|
Species | Sorghum bicolor |
Cazyme ID | Sb02g032805.1 |
Family | CBM43 |
Protein Properties | Length: 88 Molecular Weight: 9286.6 Isoelectric Point: 7.2027 |
Chromosome | Chromosome/Scaffold: 2 Start: 67433605 End: 67434015 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 1 | 83 | 3e-35 |
WCVAKPSVPGPIVQQAMDYACGSGADCDSILPSGPCYRPNTMLAHASFAFNSYWQRTKANGATCDFGGTAMLITKDPSYGGCH |
Full Sequence |
---|
Protein Sequence Length: 88 Download |
WCVAKPSVPG PIVQQAMDYA CGSGADCDSI LPSGPCYRPN TMLAHASFAF NSYWQRTKAN 60 GATCDFGGTA MLITKDPSYG GCHYILM* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-23 | 1 | 71 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-39 | 1 | 84 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF80478.2 | 3.00018e-42 | 1 | 87 | 295 | 381 | unknown [Zea mays] |
GenBank | EEC85055.1 | 1.99965e-42 | 1 | 83 | 419 | 501 | hypothetical protein OsI_32389 [Oryza sativa Indica Group] |
GenBank | EEE70222.1 | 5.99994e-41 | 16 | 87 | 465 | 536 | hypothetical protein OsJ_30336 [Oryza sativa Japonica Group] |
RefSeq | XP_002462835.1 | 0 | 1 | 87 | 1 | 87 | hypothetical protein SORBIDRAFT_02g032805 [Sorghum bicolor] |
RefSeq | XP_002516415.1 | 7.9874e-44 | 1 | 85 | 177 | 261 | conserved hypothetical protein [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-20 | 1 | 84 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL476107 | 88 | 1 | 88 | 0 |
DV522213 | 88 | 1 | 88 | 0 |
FL734786 | 88 | 1 | 88 | 0 |
CB873320 | 88 | 1 | 88 | 1.00053e-42 |
CB869536 | 88 | 1 | 88 | 1.99965e-42 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|