y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb03g023520.1
FamilyGT48
Protein PropertiesLength: 1721 Molecular Weight: 197513 Isoelectric Point: 8.2035
ChromosomeChromosome/Scaffold: 3 Start: 46965205 End: 46984150
Descriptionglucan synthase-like 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4895511910
  PYEWKNFLERIGVEPDNEVSIKGHMDDIRLWASYRGQTLARTVRGMMYYRRALELQCYEDMINDQGYGLADLDRAKAVRSKAIADIKFTYVVSCQLYGVH
  KASKDSREKGLYENILNLMLTYPALRIAYIDEKEVQLQNGKIEKQYYSVLVKGDDEEIYRIRLPGKPTEVGEGKPNNQNHAIIFTRGEALQAIDMNQDNY
  LEEAFKMRNLLEEFLLTHGKSEPTILGVREHIFTGRV
GT48118915330
  GRVRFHYGHPDVFDRLFHLTRGGISKASKVINLSEDIFAGFNSTLRQGNVTHHEYIQLGKGRDVGMNQISNFEAKVANGNGEQTLCRDIYRLGHRFDFYR
  MLSLYFTTVGFYFNSMVAVLTVYVFLYGRLYLVLSGLEKSILQDPNIQNIKPFENALATQSVFQLGMLLVLPMMMEVGLEKGFGRALAEFVIMQLQLAPV
  FFTFHLGTKTHYYGRTILHGGAKYRATGRGFVVRHAKFAENYRMYSRSHFVKALELLILLVVYLAYGSSYRSSSLYLYVTVSIWFLVFCWLFAPFIFNPS
  CFEWHKTVDDWIDWWKWMGNRGGIGLAPEQSWEAWWVYALSWLVI
Full Sequence
Protein Sequence     Length: 1721     Download
MEAGPSSSAA MSAARRRRDA LAQTLASRRL PEGMAEAGEP VPGAVAPEVM PFLRAADEIE    60
PYNPRVAFLC RKYAFKKVQT VDPSSTQRGV RQFKTYMSIK LDQDDTQVLG NDANEIQQFY    120
KKYCASMRHI SEQRNFEEMA RYYQVAYALY EVLRDVTNNK VDPQVMRCAE MVEENGRHFK    180
NYKYNIIPFN FPGSSEAIVE LPEAEIRGAM DAISDIDGLP MPHMYSIQSQ GGQSIRDVLD    240
WLSLAFGFQK SNVENQRENM VLLLANISTR TAGQEGHPLV DTVNELWKKI FGNYKSWCYY    300
LHISSSIMIS HDVTEHKKQQ LKLLHIGLYL LIWGEASNVR FMPECLCYIF HHMAKQLHDM    360
VDENYFQPPP GFEEEGSFLK NVVEPIFKVL QKTSQSGPSG PRPQAILTFV KTASFADVSM    420
LASRVGPRNV LLSLSGRGIF LLTSFIKGRV TSLQCSMAAT AATSPPPWAQ RSTARKPKTN    480
FVEVRTFLHI FRSFNRMWMF FILAFQNVME RSNSRVLVLL MWWIQPRLYV GRGMHEDILS    540
ILKYVFFWAV LLISKLAFSF YVEFAKQQCP ESLSQFIGQL ASLADDKCQL FFVWAMKLAW    600
TLDQAPSALR LWFEISPLID PTKFILDQQV GNYEWHQIFP FLPRNLGVVI TIWAPIVMVY    660
FMDTQIWYAI FSTVFGGVSG ALSHVGEPMP QDAEQIAASC LYLTNCVILD CQQAFEHRSF    720
FCVWNSFINS LREEDFISDR EKDMLIAPSY SSNLSIIQWP PFLLASKVPA AVHMAMNSKE    780
GDEHELIEKV KLDRDRYNAV IECYESLMII LNSLLLDSND QNIVNDIDRK VTYSMRNKTF    840
LEDFEMAEIG KKSEPINDVE ERKIVNALQD FMEITTRDFM KDGQSILKDE NERKQRFMNL    900
NINMIKEDSW REKFVRLHLL LTMKDSAMDV PTNLDARRRI TFFANSLFMK MPRAPYEWKN    960
FLERIGVEPD NEVSIKGHMD DIRLWASYRG QTLARTVRGM MYYRRALELQ CYEDMINDQG    1020
YGLADLDRAK AVRSKAIADI KFTYVVSCQL YGVHKASKDS REKGLYENIL NLMLTYPALR    1080
IAYIDEKEVQ LQNGKIEKQY YSVLVKGDDE EIYRIRLPGK PTEVGEGKPN NQNHAIIFTR    1140
GEALQAIDMN QDNYLEEAFK MRNLLEEFLL THGKSEPTIL GVREHIFTGR VRFHYGHPDV    1200
FDRLFHLTRG GISKASKVIN LSEDIFAGFN STLRQGNVTH HEYIQLGKGR DVGMNQISNF    1260
EAKVANGNGE QTLCRDIYRL GHRFDFYRML SLYFTTVGFY FNSMVAVLTV YVFLYGRLYL    1320
VLSGLEKSIL QDPNIQNIKP FENALATQSV FQLGMLLVLP MMMEVGLEKG FGRALAEFVI    1380
MQLQLAPVFF TFHLGTKTHY YGRTILHGGA KYRATGRGFV VRHAKFAENY RMYSRSHFVK    1440
ALELLILLVV YLAYGSSYRS SSLYLYVTVS IWFLVFCWLF APFIFNPSCF EWHKTVDDWI    1500
DWWKWMGNRG GIGLAPEQSW EAWWVYALSW LVIAVALVSL KVVSLGREKF VTRFQLVFRI    1560
LKGIVFLVLI GLLVLLFVGF DLAVADVGAS ILAFIPTGWF ILLIAQLCGP LFRRLIIEPL    1620
HLLCCPYGTG GACRGPCCAK FRQRTGAALR KMGPWDSIQE MARMYEYTMG LLIFLPIAVL    1680
SWFPFVSEFQ TRLLFNQAFS RGLQISRILA GQNGSGTRSD *                        1740
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom11.0e-2733239262+
pfam02364Glucan_synthase2.0e-1739301524735+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI22102.10341712301890unnamed protein product [Vitis vinifera]
GenBankEEC70820.10151298231355hypothetical protein OsI_02286 [Oryza sativa Indica Group]
GenBankEEC70820.101541172013781558hypothetical protein OsI_02286 [Oryza sativa Indica Group]
RefSeqXP_002457960.1050017165781790hypothetical protein SORBIDRAFT_03g023490 [Sorghum bicolor]
RefSeqXP_002457964.101172011720hypothetical protein SORBIDRAFT_03g023520 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
12921314
13701392
14411458
14631485
15221544
15561578
15821604
16671686
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780496305119014940
HO780496135106511830
HO780496230149416760
HO425519663113117120
HO78074647995513820