CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb03g030100.1
FamilyGH18
Protein PropertiesLength: 296 Molecular Weight: 30368.7 Isoelectric Point: 3.9934
ChromosomeChromosome/Scaffold: 3 Start: 58399018 End: 58400203
Descriptionchitinase A
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18262822.3e-30
  GNIAVYWGQNGNEGTLADTCNSGLYAYVILAFLTTFGNGQTPVLNLAGHCDPGSGGCTGLSSDIQTCQSQGIKVLLSIGGATGSYGLSSTDDANSVADYL
  WNSYLGGSDGSTRPLGAAVLDGVDFDIENGQSAHYDDLATALKGKGSVLLSAAPQCPYPDASLGAALQTGQFDNVWIQFYNNPGCAYANGDDTNLVNAWS
  TWTSSVTAGSFYLGLPASTQAAGSGYIEPGTLTGTVLPAIKGVGKYGGIMVWNRFYD
Full Sequence
Protein Sequence     Length: 296     Download
MATNLKWAPV LALLLVAAMV GSTSAGNIAV YWGQNGNEGT LADTCNSGLY AYVILAFLTT    60
FGNGQTPVLN LAGHCDPGSG GCTGLSSDIQ TCQSQGIKVL LSIGGATGSY GLSSTDDANS    120
VADYLWNSYL GGSDGSTRPL GAAVLDGVDF DIENGQSAHY DDLATALKGK GSVLLSAAPQ    180
CPYPDASLGA ALQTGQFDNV WIQFYNNPGC AYANGDDTNL VNAWSTWTSS VTAGSFYLGL    240
PASTQAAGSG YIEPGTLTGT VLPAIKGVGK YGGIMVWNRF YDVQNNYSAQ VKDSV*        300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3469COG34693.0e-688286241+
cd00598GH18_chitinase-like1.0e-928206193+
cd02871GH18_chitinase_D-like2.0e-1350288296+
pfam00704Glyco_hydro_181.0e-2926295301+
cd02877GH18_hevamine_XipI_class_III2.0e-13526293280+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABW75909.1012951299class III chitinase [Bambusa oldhamii]
GenBankACF88326.102629527295unknown [Zea mays]
RefSeqNP_001043772.1022953301Os01g0660200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105541.102629527294chitinase chem5 [Zea mays]
RefSeqXP_002456083.1012951295hypothetical protein SORBIDRAFT_03g030100 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gsj_A0262951271A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB2hvm_A0262951273A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB1llo_A0262951273A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity
PDB1hvq_A0262951273A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein With Chitinase And Lysozyme Activity, And Its Complex With An Inhibitor
PDB1kr0_A0262951273A Chain A, Hevamine Mutant D125aY183F IN COMPLEX WITH TETRA-Nag
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Transmembrane Domains
StartEnd
1032
4562
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CN14022724912490
EE03394428112800
CN13610324212420
CN12943924212420
CN13591324212420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01441.1Aquca_229_00003.1Aquca_037_00022.1Aquca_002_01440.1Aquca_020_00079.1
Aquca_011_00549.1
Arabidopsis lyrata489265
Arabidopsis thalianaAT5G24090.1
Brachypodium distachyonBradi2g55630.1Bradi1g52625.1Bradi2g55610.1Bradi2g55620.1Bradi2g43755.1
Bradi2g47066.1Bradi2g45610.1
Brassica rapaBra026469Bra009731
Carica papayaevm.model.supercontig_184.10evm.model.supercontig_1833.1evm.model.supercontig_3.30evm.model.supercontig_80.46evm.model.supercontig_3.24
evm.model.supercontig_3.21evm.model.supercontig_3.23evm.TU.contig_34078.1
Capsella rubellaCarubv10001507m
Citrus clementinaCiclev10005491mCiclev10024434mCiclev10005522m
Citrus sinensisorange1.1g035598morange1.1g044801morange1.1g043511m
Cucumis sativusCucsa.201870.1Cucsa.258800.1Cucsa.201840.1Cucsa.201850.1Cucsa.258820.1
Cucsa.201860.1
Eucalyptus grandisEucgr.E00091.1Eucgr.E00086.1Eucgr.E00090.1Eucgr.K00308.1Eucgr.K00311.1
Eucgr.H04884.1Eucgr.L03478.1Eucgr.K00313.1
Fragaria vescamrna15598.1-v1.0-hybridmrna18987.1-v1.0-hybridmrna18986.1-v1.0-hybridmrna18999.1-v1.0-hybridmrna13147.1-v1.0-hybrid
mrna13194.1-v1.0-hybridmrna13136.1-v1.0-hybrid
Glycine maxGlyma12g25740.1Glyma16g28970.1Glyma16g28970.2Glyma18g15310.2Glyma10g37200.1
Glyma18g15230.1Glyma20g30480.1Glyma09g23136.1Glyma20g30450.1Glyma02g12660.1
Glyma01g06720.1Glyma03g41510.1Glyma07g06760.1Glyma18g15330.1Glyma08g41100.1
Glyma15g01820.4Glyma15g01820.3Glyma15g01820.2Glyma20g04645.2Glyma20g04645.1
Glyma19g22510.1Glyma05g07193.1Glyma20g30460.1
Gossypium raimondiiGorai.004G154400.1Gorai.008G118600.1Gorai.008G128500.1Gorai.008G272100.1Gorai.008G272000.1
Gorai.004G116500.1Gorai.009G389400.1Gorai.003G123100.1Gorai.009G389700.1
Linum usitatissimumLus10040420Lus10009216Lus10040419Lus10023535Lus10037985
Lus10009215Lus10023534Lus10037984Lus10010137Lus10001868
Malus domesticaMDP0000192511MDP0000888042MDP0000789304MDP0000940313MDP0000507853
MDP0000290970MDP0000218691MDP0000287581MDP0000414607MDP0000280265
MDP0000275926MDP0000222724MDP0000217803MDP0000218640MDP0000286587
MDP0000162677MDP0000275771MDP0000179027MDP0000310481MDP0000276435
MDP0000216662MDP0000841470
Manihot esculentacassava4.1_012935mcassava4.1_025190mcassava4.1_034267mcassava4.1_029485mcassava4.1_023457m
cassava4.1_026904mcassava4.1_027845mcassava4.1_012979mcassava4.1_028683mcassava4.1_012830m
Medicago truncatulaMedtr1g099310.1Medtr8g055940.1Medtr1g099290.1Medtr5g043550.1Medtr1g099320.1
Medtr1g099350.1Medtr2g102020.1Medtr7g116850.1Medtr7g116350.1Medtr6g023340.1
Mimulus guttatusmgv1a021044mmgv1a011049mmgv1a022607mmgv1a013181m
Oryza sativaLOC_Os01g47070.1LOC_Os07g19040.1LOC_Os01g64110.1LOC_Os01g64100.1LOC_Os01g49320.1
LOC_Os01g19750.1LOC_Os04g27980.1LOC_Os07g23850.1
Panicum virgatumPavirv00056413mPavirv00047799mPavirv00036743mPavirv00000209mPavirv00002369m
Pavirv00041282mPavirv00062095mPavirv00042577mPavirv00036741mPavirv00047846m
Pavirv00062097mPavirv00062098mPavirv00036739mPavirv00049525mPavirv00009907m
Pavirv00003256mPavirv00064592m
Phaseolus vulgarisPhvul.011G167300.1Phvul.004G101500.1Phvul.002G069300.1Phvul.003G049100.1Phvul.007G077800.1
Phvul.003G049000.1Phvul.006G109000.1Phvul.011G167000.1Phvul.011G166900.1
Populus trichocarpaPotri.015G023900.1Potri.015G024100.1Potri.015G024000.1Potri.012G033900.1Potri.014G091700.1
Potri.002G165700.1Potri.015G024200.1Potri.002G242000.1Potri.014G092800.1Potri.014G091600.1
Prunus persicappa009328mppa024550mppa021993mppa026927mppa022614m
ppa015812mppa023419mppa009248mppa023573m
Ricinus communis30169.m00655630174.m00867730169.m00655729717.m00023029595.m000280
30174.m00867830174.m008684
Setaria italicaSi033231mSi002396mSi002395mSi002419mSi002402m
Si039207mSi002411mSi003958mSi004596m
Selaginella moellendorffii12620315257232123231185409562.377.598
409562.377.598232630409562.48.270409562.48.27092194
236715
Sorghum bicolorSb02g009370.1Sb02g009360.1Sb02g009380.1Sb03g040600.1Sb02g009390.1
Sb03g040570.1Sb01g050530.1Sb03g040560.1Sb03g040580.1Sb03g040590.1
Sb03g031710.1
Thellungiella halophilaThhalv10004675m
Vitis viniferaGSVIVT01027027001GSVIVT01028752001GSVIVT01027012001GSVIVT01028750001GSVIVT01032411001
GSVIVT01027014001GSVIVT01027022001GSVIVT01027026001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)