| Basic Information | |
|---|---|
| Species | Sorghum bicolor |
| Cazyme ID | Sb03g036660.2 |
| Family | AA6 |
| Protein Properties | Length: 153 Molecular Weight: 15986.2 Isoelectric Point: 6.9701 |
| Chromosome | Chromosome/Scaffold: 3 Start: 64749302 End: 64750209 |
| Description | Quinone reductase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA6 | 1 | 147 | 0 |
| MGAPPKPDVPVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGIFFSTGTQGGGQETTPLTAITQLTHHGMVFVPVGYTFGAK LFGMDQVQGGSPYGAGTFAADGSRWPSEVELEHAFHQGKYFAGIAKK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 153 Download |
| MGAPPKPDVP VITPQELAEA DGILFGFPTR FGMMAAQMKA FFDATGGLWR EQSLAGKPAG 60 IFFSTGTQGG GQETTPLTAI TQLTHHGMVF VPVGYTFGAK LFGMDQVQGG SPYGAGTFAA 120 DGSRWPSEVE LEHAFHQGKY FAGIAKKLKG SA* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02525 | Flavodoxin_2 | 0.006 | 15 | 64 | 58 | + Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258. | ||
| pfam03358 | FMN_red | 2.0e-10 | 1 | 95 | 95 | + NADPH-dependent FMN reductase. | ||
| COG0655 | WrbA | 5.0e-32 | 15 | 150 | 137 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
| TIGR01755 | flav_wrbA | 5.0e-44 | 9 | 148 | 141 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
| PRK03767 | PRK03767 | 2.0e-55 | 10 | 150 | 142 | + NAD(P)H:quinone oxidoreductase; Provisional | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACF86423.1 | 0 | 1 | 152 | 52 | 203 | unknown [Zea mays] |
| GenBank | EAY76084.1 | 0 | 1 | 152 | 52 | 203 | hypothetical protein OsI_04011 [Oryza sativa Indica Group] |
| RefSeq | NP_001044464.1 | 0 | 1 | 152 | 52 | 203 | Os01g0784800 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001149575.1 | 0 | 1 | 152 | 52 | 203 | LOC100283201 [Zea mays] |
| RefSeq | NP_001151729.1 | 0 | 1 | 152 | 52 | 203 | LOC100285365 [Zea mays] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4dy4_C | 0 | 10 | 150 | 58 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 4dy4_A | 0 | 10 | 150 | 58 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6m_B | 0 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6m_A | 0 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| PDB | 3b6k_B | 0 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FL939663 | 153 | 1 | 153 | 0 |
| DN146424 | 153 | 1 | 153 | 0 |
| FE636222 | 153 | 1 | 153 | 0 |
| FL783855 | 153 | 1 | 153 | 0 |
| BM953679 | 153 | 1 | 153 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
