y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb04g031440.1
FamilyGT57
Protein PropertiesLength: 518 Molecular Weight: 57947.7 Isoelectric Point: 9.2977
ChromosomeChromosome/Scaffold: 4 Start: 61412398 End: 61416000
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57225090
  ATCVKLLLVPTYRSTDFDVHRYWLALTHALPARQWYTDASSQWTLDYPPFFAYFSRILSLPAPLVDAALVSVPVPDAPPFAHLLYLRLTVAFSDLLLLGS
  VLLLARDARRKQRPFLALALVLWSPALLAVDHVHFQYNGFLMGLLLLSLHFLEQGWDLAGGVVFASLLCSKHLFLVAAPVYFMYLFRHYCCGRGVVKGLG
  RLVLMGSGVAAVFAAAFVPFVYYGQMQQLINRLFPFGRGLCHAYWAPNFWVFYIILDKILAFLLRRLGFNIAIPEASFTGGLVGDSSPFAVLPKVTPIAT
  FLLVILAMAPCLIKAFSNPQPKHIIRWVSYACTCGFMFGWHVHEKASLHFTIPLALIAMDSLNDSRHYFLLSIVSCYSLFPLLFENQEYLIKVMLLLTYA
  ALMWVGFTSHFAANSDLEGKKVNRSGSTVKKNGIIGWIGLSYLLGIAGIELWSRVFHHHVFGERLPFLPLIMVSFYCGLGMMYSWVWQ
Full Sequence
Protein Sequence     Length: 518     Download
MAYTTSPSPA AAVAVAWAFA AATCVKLLLV PTYRSTDFDV HRYWLALTHA LPARQWYTDA    60
SSQWTLDYPP FFAYFSRILS LPAPLVDAAL VSVPVPDAPP FAHLLYLRLT VAFSDLLLLG    120
SVLLLARDAR RKQRPFLALA LVLWSPALLA VDHVHFQYNG FLMGLLLLSL HFLEQGWDLA    180
GGVVFASLLC SKHLFLVAAP VYFMYLFRHY CCGRGVVKGL GRLVLMGSGV AAVFAAAFVP    240
FVYYGQMQQL INRLFPFGRG LCHAYWAPNF WVFYIILDKI LAFLLRRLGF NIAIPEASFT    300
GGLVGDSSPF AVLPKVTPIA TFLLVILAMA PCLIKAFSNP QPKHIIRWVS YACTCGFMFG    360
WHVHEKASLH FTIPLALIAM DSLNDSRHYF LLSIVSCYSL FPLLFENQEY LIKVMLLLTY    420
AALMWVGFTS HFAANSDLEG KKVNRSGSTV KKNGIIGWIG LSYLLGIAGI ELWSRVFHHH    480
VFGERLPFLP LIMVSFYCGL GMMYSWVWQL VHIVRHT*                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg82.0e-7323508501+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD07664.102351621518putative glucosyltransferase [Oryza sativa Japonica Group]
GenBankEAY87118.102351621518hypothetical protein OsI_08520 [Oryza sativa Indica Group]
RefSeqNP_001047779.102351618515Os02g0688500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_181994.501751414505transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002454458.1015171517hypothetical protein SORBIDRAFT_04g031440 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5471EC-2.4.1.265Dol-P-Glc:Glc1Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
1335
104126
139161
181203
223245
255277
284306
316338
345364
388405
412434
454473
486508
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0409202762435180
FL7685902093105180
GT8126052401784170
GD0227861923004910
GD022786314875174.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brachypodium distachyonBradi3g52040.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Fragaria vescamrna03056.1-v1.0-hybrid
Glycine maxGlyma08g10420.1Glyma05g27431.2Glyma05g27431.1
Gossypium raimondiiGorai.003G062300.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2Phvul.007G221000.1
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny