CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb05g001900.1
FamilyGH51
Protein PropertiesLength: 672 Molecular Weight: 73973.2 Isoelectric Point: 4.762
ChromosomeChromosome/Scaffold: 5 Start: 2064829 End: 2070633
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511886620
  DGLQNLASATITVSGESNWTKVEQKLVAKGTNRTSRLQITTNKKGVVWFDQVSLMPEDTYKGHGFRTELISMILDLKPRFLRFPGGCFVEGEWLRNAFRW
  RESIGPWEERPGHFGDVWHYWTDDGLGYYEFLQLAEDLDAEPIWVFNNGVSHNDEVDTAAIAPFVKDVLDSIEFARGSANSTWGSVRAAMGHPEPFPVKY
  VAIGNEDCGKKFYRGNYLKFYNAIRQAYPDIQMISNCDGSSTPLDHPADLYDFHVYTDSKTLFNMKSTFDRTSRSGPKAFVSEYAVWRGDAGRGSLLASL
  AEAAFLTGLEKNSDIVYMASYAPLFVNNNDQTWNPDAIVFNSWQHYGTPSYWMQTLFRESSGAMLHPTTISSSYSGSLAASAITWQDSENSFLRVKVINF
  GSDAVTLTISTTGLQASINALGSTATVLTSANVMDENSFSNPTKVVPVKSDMSNAAEQMQVTLAPHSFSSFDLAL
Full Sequence
Protein Sequence     Length: 672     Download
MVDACSTRVD KWKPMGTGKD AAPRAILCFL FLFCLGCKCL ASELEATQTA TLTVDASPQL    60
ARKIPDTLFG IFFEEINHAG AGGIWAELVS NRGFEAGGLH TPSNIDPWSI IGDDSSIYVE    120
TDRTSCFSRN IIALRMEVLC DNCPTGGVGI YNPGFWGMNI EDGKAYNLVM YVKSPETTDL    180
IVSLTSSDGL QNLASATITV SGESNWTKVE QKLVAKGTNR TSRLQITTNK KGVVWFDQVS    240
LMPEDTYKGH GFRTELISMI LDLKPRFLRF PGGCFVEGEW LRNAFRWRES IGPWEERPGH    300
FGDVWHYWTD DGLGYYEFLQ LAEDLDAEPI WVFNNGVSHN DEVDTAAIAP FVKDVLDSIE    360
FARGSANSTW GSVRAAMGHP EPFPVKYVAI GNEDCGKKFY RGNYLKFYNA IRQAYPDIQM    420
ISNCDGSSTP LDHPADLYDF HVYTDSKTLF NMKSTFDRTS RSGPKAFVSE YAVWRGDAGR    480
GSLLASLAEA AFLTGLEKNS DIVYMASYAP LFVNNNDQTW NPDAIVFNSW QHYGTPSYWM    540
QTLFRESSGA MLHPTTISSS YSGSLAASAI TWQDSENSFL RVKVINFGSD AVTLTISTTG    600
LQASINALGS TATVLTSANV MDENSFSNPT KVVPVKSDMS NAAEQMQVTL APHSFSSFDL    660
ALAQSKLVAE M* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06964Alpha-L-AF_C3.0e-32469654203+
COG3534AbfA1.0e-33251656482+
smart00813Alpha-L-AF_C2.0e-46469654198+
Gene Ontology
GO TermDescription
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27961.10196714656unknown [Zea mays]
GenBankACN33779.1016711680unknown [Zea mays]
GenBankEEC67598.103667121658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
RefSeqNP_001148977.1016711680alpha-N-arabinofuranosidase A [Zea mays]
RefSeqXP_002442705.10196714656hypothetical protein SORBIDRAFT_08g001540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L1e-2225166248483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K1e-2225166248483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J1e-2225166248483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I1e-2225166248483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H1e-2225166248483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0462043482365830
GO8018603291044320
GT0486153482966420
GT036166331413710
HO8526834262516720
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb08g001540.1Sb05g007100.1Sb02g043530.1Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)