y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb05g026810.3
FamilyGH1
Protein PropertiesLength: 650 Molecular Weight: 73234.6 Isoelectric Point: 7.3397
ChromosomeChromosome/Scaffold: 5 Start: 60763003 End: 60766822
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11785490
  WHNVPCPQERLKFWSDPDTELKLAKETGISVFRLGIDWTRVMPKAPTEESKSSVNFAALERYRWIIQRVHEYGMKVMLTLFHHSLPPWAGEYGGWRMEKT
  VKYFMDFVRLVVDRVSDLVDYWVVFNEPHVFVMLTYCAGAWPGGDPNAIEVATSALPTGVYNQALHWMAIAHAEAYDYIHSESKSKRKPFVGVAHHVSFT
  RPYGLFDVAAVTLANSLTLFPYVDSICDKLDFIGINYYGQEVISGPGLKLVDNDEYSESGRGVYPDGLFRILIQFNERYKSLNIPFIITENGVSDETDLI
  RKPYILEHLLAIYAAIIMGVPVLGYLFWTMSDNWEWADGYGPKFGLVAVDRANNLARKPRPSYYLFSKVVTT
Full Sequence
Protein Sequence     Length: 650     Download
MPLPAFLAAA ARLAVLVAAA VTAANAASFA RYRRRHLRRI PNPIDESADP IADFRALPSN    60
SAAASAEDGN FFFGLATAPA HVEDRLEDAW LQFAVEHSCD DKEAMRDHKT ADAVMASAAG    120
DGGAQLASRS RGDEKAVDGE KRKPLKVAME AMLRGFEMFA YGGEAGSGDN CSHNVAAWHN    180
VPCPQERLKF WSDPDTELKL AKETGISVFR LGIDWTRVMP KAPTEESKSS VNFAALERYR    240
WIIQRVHEYG MKVMLTLFHH SLPPWAGEYG GWRMEKTVKY FMDFVRLVVD RVSDLVDYWV    300
VFNEPHVFVM LTYCAGAWPG GDPNAIEVAT SALPTGVYNQ ALHWMAIAHA EAYDYIHSES    360
KSKRKPFVGV AHHVSFTRPY GLFDVAAVTL ANSLTLFPYV DSICDKLDFI GINYYGQEVI    420
SGPGLKLVDN DEYSESGRGV YPDGLFRILI QFNERYKSLN IPFIITENGV SDETDLIRKP    480
YILEHLLAIY AAIIMGVPVL GYLFWTMSDN WEWADGYGPK FGLVAVDRAN NLARKPRPSY    540
YLFSKVVTTG KITRQDRLGA WRELQQAAFQ KKTRPFFRAV DKHGRMYAGG LDRPIQRPFI    600
LRDWRFGHYE MEGLQDPFSR FIRSIFSPIL RKKKIHYIEY EDISYAISP*               660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028148.0e-20197564425+
PRK13511PRK135115.0e-24197552438+
TIGR03356BGL6.0e-48198543392+
pfam00232Glyco_hydro_15.0e-49195549411+
COG2723BglB8.0e-60198553412+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG27984.102864828656SFR2 [Zea mays]
GenBankACL54550.102864828655unknown [Zea mays]
GenBankEAY81793.104064840646hypothetical protein OsI_36965 [Oryza sativa Indica Group]
RefSeqNP_001068463.104064840647Os11g0683500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105868.102864828657putative beta-glycosidase [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ta9_B2e-4019755271455A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii
PDB3ta9_A2e-4019755271455A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii
PDB1vff_A4e-3816755242408A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB3apg_D1e-3718355551460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C1e-3718355551460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
1029
486508
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8386793173126280
GO8410083252115350
GO8544993302185470
GO8579233062245290
GO857923435295710.11
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny