Basic Information | |
---|---|
Species | Sorghum bicolor |
Cazyme ID | Sb06g015880.1 |
Family | GH16 |
Protein Properties | Length: 281 Molecular Weight: 30831.4 Isoelectric Point: 4.6888 |
Chromosome | Chromosome/Scaffold: 6 Start: 43936495 End: 43937960 |
Description | Xyloglucan endotransglucosylase/hydrolase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 40 | 207 | 3.5e-27 |
RTNYDESGAQVAMLNLDRSSGAGFNSKEQYLYGQFSVQMKLIPGNSAGTVSCFYLSSGDGDGHDEIDMEFMGNATGQPVVLNTNVWANGDGKKEHQFDLW FDPAADYHTYTIIWNPTNILFKVDDNVIRVFKRYADLAYPSSKPMTLHATLWDGSYWATEKGKVPIDW |
Full Sequence |
---|
Protein Sequence Length: 281 Download |
MARRSLALLL ASSLALVMMA AVASADSWLY EKFSTDGTVR TNYDESGAQV AMLNLDRSSG 60 AGFNSKEQYL YGQFSVQMKL IPGNSAGTVS CFYLSSGDGD GHDEIDMEFM GNATGQPVVL 120 NTNVWANGDG KKEHQFDLWF DPAADYHTYT IIWNPTNILF KVDDNVIRVF KRYADLAYPS 180 SKPMTLHATL WDGSYWATEK GKVPIDWSGA PFVVSYKGYS ADACVSGGAC AAGSGAWMNK 240 QPDSAEWGTV KWAESNYMRY NYCDDGWRFP QGLPAECSRS * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd02183 | GH16_fungal_CRH1_transglycosylase | 8.0e-17 | 41 | 217 | 189 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
cd02175 | GH16_lichenase | 2.0e-19 | 59 | 194 | 138 | + lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure. | ||
pfam00722 | Glyco_hydro_16 | 1.0e-64 | 49 | 209 | 162 | + Glycosyl hydrolases family 16. | ||
PLN03161 | PLN03161 | 2.0e-65 | 53 | 279 | 239 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
cd02176 | GH16_XET | 7.0e-111 | 30 | 277 | 258 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG37530.1 | 0 | 26 | 280 | 25 | 280 | xyloglucan endotransglycosylase/hydrolase protein 8 precursor [Zea mays] |
GenBank | ACN28585.1 | 0 | 26 | 280 | 25 | 280 | unknown [Zea mays] |
RefSeq | NP_001105166.1 | 0 | 26 | 280 | 25 | 280 | xyloglucan endo-transglycosylase/hydrolase [Zea mays] |
RefSeq | XP_002446422.1 | 0 | 1 | 280 | 1 | 280 | hypothetical protein SORBIDRAFT_06g015880 [Sorghum bicolor] |
RefSeq | XP_002446425.1 | 0 | 24 | 279 | 20 | 276 | hypothetical protein SORBIDRAFT_06g015930 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 46 | 279 | 34 | 274 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 1un1_A | 0 | 46 | 279 | 34 | 274 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 1umz_B | 0 | 46 | 279 | 34 | 274 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 46 | 279 | 34 | 274 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2vh9_B | 0 | 55 | 277 | 67 | 290 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
Transmembrane Domains | ||||
---|---|---|---|---|
Start | End | |||
7 | 29 |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
25 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE047776 | 257 | 26 | 281 | 0 |
EC901295 | 257 | 26 | 281 | 0 |
EE157049 | 257 | 26 | 281 | 0 |
EE154499 | 257 | 26 | 281 | 0 |
EE046191 | 245 | 26 | 269 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|