| Basic Information | |
|---|---|
| Species | Sorghum bicolor |
| Cazyme ID | Sb06g022470.1 |
| Family | GH1 |
| Protein Properties | Length: 133 Molecular Weight: 15394.5 Isoelectric Point: 9.6699 |
| Chromosome | Chromosome/Scaffold: 6 Start: 51703184 End: 51705514 |
| Description | beta glucosidase 46 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 1 | 112 | 1.54143e-44 |
| MEQVVMYYKERYNNTPIYITENGYAQGSNSSMSAKDFTNDTPRINYIRDYLTFLASAIRNGADVRGYFIWSLLDCFEWTSGYTLRLGLCHVDFNTLKRTP KLSANWFRKFLK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 133 Download |
| MEQVVMYYKE RYNNTPIYIT ENGYAQGSNS SMSAKDFTND TPRINYIRDY LTFLASAIRN 60 GADVRGYFIW SLLDCFEWTS GYTLRLGLCH VDFNTLKRTP KLSANWFRKF LKGSLVGTRL 120 RDKSSQLQHY TA* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 5.0e-30 | 4 | 109 | 112 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PRK13511 | PRK13511 | 1.0e-30 | 1 | 109 | 110 | + 6-phospho-beta-galactosidase; Provisional | ||
| PLN02814 | PLN02814 | 1.0e-31 | 1 | 115 | 117 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 6.0e-38 | 4 | 113 | 111 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 4.0e-39 | 1 | 107 | 107 | + beta-galactosidase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001053302.1 | 0 | 1 | 132 | 385 | 515 | Os04g0513100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002448169.1 | 5.60519e-45 | 1 | 113 | 381 | 493 | hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor] |
| RefSeq | XP_002448173.1 | 0 | 1 | 132 | 386 | 515 | hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor] |
| RefSeq | XP_002448174.1 | 0 | 1 | 132 | 388 | 516 | hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor] |
| RefSeq | XP_002448175.1 | 0 | 1 | 132 | 1 | 132 | hypothetical protein SORBIDRAFT_06g022470 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 4e-31 | 1 | 112 | 377 | 489 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3gnr_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3gnp_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3gno_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 2rgm_B | 2e-30 | 1 | 112 | 371 | 480 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BE596935 | 133 | 1 | 133 | 0 |
| BM328243 | 114 | 20 | 133 | 0 |
| JG911579 | 133 | 1 | 132 | 0 |
| HO293838 | 133 | 1 | 132 | 0 |
| HO293837 | 130 | 1 | 129 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Fragaria vesca | mrna19576.1-v1.0-hybrid | ||||
| Panicum virgatum | Pavirv00028433m | Pavirv00028432m | Pavirv00056463m | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |