CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb06g022510.1
FamilyGH1
Protein PropertiesLength: 517 Molecular Weight: 58559.5 Isoelectric Point: 7.1386
ChromosomeChromosome/Scaffold: 6 Start: 51733520 End: 51737646
Descriptionbeta glucosidase 46
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1395110
  RSDFPASFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHAPGRIKDRSTGDVADDHYHRYEEDIELMHSLGTNAYRFSISWARVLPKGRFGKVNPAGIAFY
  NKLIDSLLLKGIEPFVTLTHYDTPQELEDRYGAWLSAEARRDFGHLADVCFAAFGDRVKYWSTFNEPNVVVTRGYMVGTYPPERCSPPLGSCARGNSDAE
  PYVATHNVVLAHATAVEIYKRKYQSKQKGMIGIVMSALWLVPLTDTPVDRLATERALAFDAPWFLDPIIYGDYPPEMRQLLGSKLPTFSPEERRKLGYKL
  DFIGINHYTTLYAKDCMFSSGCPSSGQEIHHALAAFTGERNGIPIGPPTAMPKFYFVPDGIEKMVTYIMKRYNNLPMFITENGYAQGGDSYTNVEDWLDD
  QGRIQYLDGYLTKLAKVIRDGADVRGYFVWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYKRFLQS
Full Sequence
Protein Sequence     Length: 517     Download
MAAAGSWPRA SARRLLLAGA YYSLLWLLDL PWATAAVRRS DFPASFLFGT ATSSYQIEGA    60
YLEGNKSLSN WDVFTHAPGR IKDRSTGDVA DDHYHRYEED IELMHSLGTN AYRFSISWAR    120
VLPKGRFGKV NPAGIAFYNK LIDSLLLKGI EPFVTLTHYD TPQELEDRYG AWLSAEARRD    180
FGHLADVCFA AFGDRVKYWS TFNEPNVVVT RGYMVGTYPP ERCSPPLGSC ARGNSDAEPY    240
VATHNVVLAH ATAVEIYKRK YQSKQKGMIG IVMSALWLVP LTDTPVDRLA TERALAFDAP    300
WFLDPIIYGD YPPEMRQLLG SKLPTFSPEE RRKLGYKLDF IGINHYTTLY AKDCMFSSGC    360
PSSGQEIHHA LAAFTGERNG IPIGPPTAMP KFYFVPDGIE KMVTYIMKRY NNLPMFITEN    420
GYAQGGDSYT NVEDWLDDQG RIQYLDGYLT KLAKVIRDGA DVRGYFVWSL IDNFEWLYGY    480
TLRFGLHYVD YQTQERKPKS SALWYKRFLQ SFVEAQ* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028491.0e-13639510477+
COG2723BglB4.0e-14042511485+
PLN02814PLN028146.0e-14436514482+
TIGR03356BGL4.0e-16643505464+
pfam00232Glyco_hydro_14.0e-17642508471+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001140717.1095164511hypothetical protein LOC100272792 [Zea mays]
RefSeqNP_001148165.1095164510beta-glucosidase [Zea mays]
Swiss-ProtQ7XSK003751627505BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor
RefSeqXP_002448178.102951624510hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
RefSeqXP_002448179.1015161516hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B03750929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A03750929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_B03750929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_A03750929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptk_B03750929503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL9415132531754270
FL8418542511524020
FG552014259372950
FL799881242733140
CA284709223953170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022500.1Sb06g022410.1Sb06g022490.1
Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)