y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb06g024946.1
FamilyGT1
Protein PropertiesLength: 461 Molecular Weight: 49731.7 Isoelectric Point: 6.1975
ChromosomeChromosome/Scaffold: 6 Start: 53968484 End: 53969866
DescriptionUDP-glycosyltransferase 73B4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1374411.5e-39
  AAPAEHVRQARARVHGWGDAAAAARGVEFHELAISEYVSPLPDPAADSPFPSHLMLLWEAFAASAPAALAALLGAISASHRRVVVLYDLMNAFAAKEAAR
  LPNGEGYTLHCTAVSSILGRMEGGSDLLRERGLEYLPINPYVTEEFLEFAGKRARAAQTIPSSAGIVMNSCHALEGEFIDFVAQKLAAGGKKVFCIGPLN
  PLLDSSAHEQGARRHECLVWLDRQPPASVLYVSFGSTSSLRGEQIAELAAALRGSNQRFIWVLRDADRGNIFADNGESRHAKFLSEFAKETEGTGLVITG
  WAPQLEILAHGATAAFMSHCGWNSTVESMSHGKPILAWPMHSDQPWDAELVCEYLKAGFLVRPCEKHAEVIPAATIQEVIERMMVSDEGLPVRQRATAIG
  EAVRS
Full Sequence
Protein Sequence     Length: 461     Download
MESVTVVAVP FPAQGHLNQL LHLSLLLAAR GLPVHYAAPA EHVRQARARV HGWGDAAAAA    60
RGVEFHELAI SEYVSPLPDP AADSPFPSHL MLLWEAFAAS APAALAALLG AISASHRRVV    120
VLYDLMNAFA AKEAARLPNG EGYTLHCTAV SSILGRMEGG SDLLRERGLE YLPINPYVTE    180
EFLEFAGKRA RAAQTIPSSA GIVMNSCHAL EGEFIDFVAQ KLAAGGKKVF CIGPLNPLLD    240
SSAHEQGARR HECLVWLDRQ PPASVLYVSF GSTSSLRGEQ IAELAAALRG SNQRFIWVLR    300
DADRGNIFAD NGESRHAKFL SEFAKETEGT GLVITGWAPQ LEILAHGATA AFMSHCGWNS    360
TVESMSHGKP ILAWPMHSDQ PWDAELVCEY LKAGFLVRPC EKHAEVIPAA TIQEVIERMM    420
VSDEGLPVRQ RATAIGEAVR SSAADGGTSF RDLENFIAHI T                        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021673.0e-42193460272+
PLN00164PLN001641.0e-45200454267+
PLN02863PLN028632.0e-46198460270+
PLN02448PLN024481.0e-46202461267+
PLN03007PLN030073.0e-52198461277+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT42163.1014611461putative cis-zeatin O-glucosyltransferase [Sorghum bicolor]
EMBLCAH66756.1024619463OSIGBa0158F05.5 [Oryza sativa (indica cultivar-group)]
RefSeqNP_001136576.1014613467hypothetical protein LOC100216698 [Zea mays]
RefSeqXP_002446923.1014611463hypothetical protein SORBIDRAFT_06g024950 [Sorghum bicolor]
RefSeqXP_002448304.1014611461hypothetical protein SORBIDRAFT_06g024946 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A1.99965e-42176453176460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vch_A1.99965e-42176453176460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vce_A1.99965e-42176453176460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A1.99965e-42646011477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acv_B7e-34191461204462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ9028172731894610
BQ9027682731894610
FE6315142411834230
JG7965382312104400
EG3969312532094610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1Sb06g024970.1
Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)