y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb06g024960.1
FamilyGT1
Protein PropertiesLength: 465 Molecular Weight: 50469.2 Isoelectric Point: 6.4664
ChromosomeChromosome/Scaffold: 6 Start: 53977759 End: 53979169
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1314436.8e-38
  GLPVHYAAPAAQVRQARARVHGWDETALRSVEFHDLGISEYVSPPPDPTAPSPFPTHLMPLFEAYTAGARAPLAALLARLSASHRRVVVVHDRINAYAAE
  EAARLHNGEAFGLHCLAASTLAGKTDAGLRLLRERGLAFLDVAHHASREFADYVAKRAMPTKDISPGAGILVNSCRALEGEFIDVVAGDLAADGKKYFAV
  GPFNPLLDLRADAQTQSKPRHECLDWLDKQPPASVLYVSFGTTSSLRTEQIAELAAALRDSDQRFIWVLRDADRGNESADDGESQNRHAELLSKFTDQTE
  GRGRVITGWAPQLEILAHGATAAFMSHCGWNSTMESLSNGKPILAWPMHSDQPWDAELVCKYLNAGILVRPWEKHGEVIPAEVIRQVIEDAMLSDQGVAV
  RQRAKVLGEAVRA
Full Sequence
Protein Sequence     Length: 465     Download
MESVAVVAVP FPAQGHLNQL LHLSLQLASR GLPVHYAAPA AQVRQARARV HGWDETALRS    60
VEFHDLGISE YVSPPPDPTA PSPFPTHLMP LFEAYTAGAR APLAALLARL SASHRRVVVV    120
HDRINAYAAE EAARLHNGEA FGLHCLAAST LAGKTDAGLR LLRERGLAFL DVAHHASREF    180
ADYVAKRAMP TKDISPGAGI LVNSCRALEG EFIDVVAGDL AADGKKYFAV GPFNPLLDLR    240
ADAQTQSKPR HECLDWLDKQ PPASVLYVSF GTTSSLRTEQ IAELAAALRD SDQRFIWVLR    300
DADRGNESAD DGESQNRHAE LLSKFTDQTE GRGRVITGWA PQLEILAHGA TAAFMSHCGW    360
NSTMESLSNG KPILAWPMHS DQPWDAELVC KYLNAGILVR PWEKHGEVIP AEVIRQVIED    420
AMLSDQGVAV RQRAKVLGEA VRACLADGGS SRKDLDDFIA HITK*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021673.0e-47196462273+
PLN00164PLN001641.0e-47198451259+
PLN02554PLN025542.0e-48199464280+
PLN02448PLN024482.0e-49228464241+
PLN03007PLN030079.0e-52199463273+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACD03254.1014648465UDP-glycosyltransferase UGT93B9 [Avena strigosa]
GenBankACD03259.10246311472UDP-glycosyltransferase UGT93B8 [Avena strigosa]
EMBLCAH66756.1024649464OSIGBa0158F05.5 [Oryza sativa (indica cultivar-group)]
RefSeqXP_002437484.1014641463hypothetical protein SORBIDRAFT_10g027940 [Sorghum bicolor]
RefSeqXP_002448305.1014641464hypothetical protein SORBIDRAFT_06g024960 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A064559460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vch_A064559460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2vce_A064559460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A2e-38646211477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acv_B4e-35199463214462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA0969102282014280
BQ9028172811854650
BQ9027682811854650
EG3969312592074650
FE6155192542124650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024950.1Sb10g027940.1Sb02g041935.1Sb06g024970.1
Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)