CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb06g033840.1
FamilyAA2
Protein PropertiesLength: 363 Molecular Weight: 38489.4 Isoelectric Point: 5.0383
ChromosomeChromosome/Scaffold: 6 Start: 61776128 End: 61778230
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2723230
  RDIGIAAGLIRIFFHDCFPQGCDASVLLSGPKSEQIEIPNQTLRPAALKLIDDIRADVHATCGPTVSCADITTLATRDAVVASGGPFFDVPLGRRDGLAP
  ASSDLVGTLPAPFFDVPTLISAFENRGLNKADLVALSGAHTVGRGHCSSFSDRLPPNADDDTMDPAFRRKLAAKCASDPSGNVVTQVLDVRTPDAFDNKY
  YFDLIAKQGLFKSDQGLINHPDTMRTATRFALNQAAFFEQFARSFVKMSQMD
Full Sequence
Protein Sequence     Length: 363     Download
MGRSSRCSCS RSVAAVQLLV AISAVCGAAL SSATVTVNEP DIANGLSWRF YDASCPYVED    60
IVSWHVTEAL RRDIGIAAGL IRIFFHDCFP QGCDASVLLS GPKSEQIEIP NQTLRPAALK    120
LIDDIRADVH ATCGPTVSCA DITTLATRDA VVASGGPFFD VPLGRRDGLA PASSDLVGTL    180
PAPFFDVPTL ISAFENRGLN KADLVALSGA HTVGRGHCSS FSDRLPPNAD DDTMDPAFRR    240
KLAAKCASDP SGNVVTQVLD VRTPDAFDNK YYFDLIAKQG LFKSDQGLIN HPDTMRTATR    300
FALNQAAFFE QFARSFVKMS QMDVLTGTAG EIRLNCSVPN IVVSSSAHTA AGDGDEGRAA    360
DE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like7.0e-2376321275+
pfam00141peroxidase1.0e-5562213152+
PLN03030PLN030309.0e-6350340300+
cd00693secretory_peroxidase2.0e-14645338301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACA05820.103436126356anionic peroxidase [Zea mays]
GenBankACF81556.103436133363unknown [Zea mays]
RefSeqNP_001105489.103436126355anionic peroxidase [Zea mays]
RefSeqNP_001132567.103036126354hypothetical protein LOC100194034 [Zea mays]
RefSeqXP_002448820.1013621362hypothetical protein SORBIDRAFT_06g033840 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0393402305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1sch_B0463402294A Chain A, Peanut Peroxidase
PDB1sch_A0463402294A Chain A, Peanut Peroxidase
PDB1gx2_B0463403306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1gx2_A0463403306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CN12682725212520
CX615363234923250
CT854010313283400
CN14143223212320
CD42845622412240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27200.1
Bradi5g27170.1Bradi5g27160.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Fragaria vescamrna27591.1-v1.0-hybrid
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma20g30910.1Glyma16g27880.1Glyma16g27900.1
Glyma10g36690.1Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_025536mcassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254m
cassava4.1_010776mcassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)