y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb07g001140.1
FamilyGH116
Protein PropertiesLength: 930 Molecular Weight: 101673 Isoelectric Point: 5.6827
ChromosomeChromosome/Scaffold: 7 Start: 1107165 End: 1112187
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1164988600
  GQFLYLEGMEYNMYNTYDVHFYASFALLSLFPSLELSLQRDFARAVLLHDPRRRRTFDGRTVPRKVLGTVPHDVGLNDPWVEMNEYMLHDPALWKDLNPK
  FVLQVYRDAVATGDAAFAEAAWPAVYIAMAYMHQFDRDGDGMVENEGIPDQTYDIWSVSGVSAYTGGLWVAALEAAAGMARVVGDRHAEAYFRGRRDRAA
  RVYDAELWNGTYFRYDNSGGGACSESIMADQMAGQWYARACGMEPVVEEGKARSALATVLDYNVMRVKGGAVGAVNGMRPDGAVDASSGQSKEVWPGVTY
  AVAAAMVHEGMHEAAFRTAKGAHDAGWGKDGFGYAFQTPEAWTEDGGYRSLHYMRPLGIWAMQ
Full Sequence
Protein Sequence     Length: 930     Download
MGSEELQQAK VLSSIDCSQP PARTWQRRFD DEGKKVAMYS LTMNDLTAIV GVYDPLRKWM    60
DNCYRGVPLG GIGAGSIGRS YRGYFQQFQI FPATNEEKPI LANQFSAFVS RPNGTKYSTV    120
LSAPTADLLK EVDKASIGSW DWKLKEEKCT YHALFPRSWT VYDGEPDPEI KITSRQISPF    180
IPHNYRESSF PAAVFTFTVH NSGSTAADVT LLFTWANSVG GKSELTGNHV NSKMTEQDGV    240
HGVLLHHRTA GGHPPVTFAI ASQETDGVRV SVCPSFTMGP SGSRDFTAAD MWDEIKKHGA    300
FGHAGAGNAA RAASKAGSSL GAAVAASTTV PAGETRVVSF SLAWACPDIK FPAGSTYHRR    360
YTKFYGVDAD AAAEQLAHDA LLEHMNWESQ IEEWQRPILN DKRLPEWYPV ALFNELYYLN    420
AGGTIWTDGQ PPKKAGFASS LTGTEPFSID TLLAEDGGTG GSAVDGVVRA VASAKELSHS    480
AAAAFGAALL RDGEDNVGQF LYLEGMEYNM YNTYDVHFYA SFALLSLFPS LELSLQRDFA    540
RAVLLHDPRR RRTFDGRTVP RKVLGTVPHD VGLNDPWVEM NEYMLHDPAL WKDLNPKFVL    600
QVYRDAVATG DAAFAEAAWP AVYIAMAYMH QFDRDGDGMV ENEGIPDQTY DIWSVSGVSA    660
YTGGLWVAAL EAAAGMARVV GDRHAEAYFR GRRDRAARVY DAELWNGTYF RYDNSGGGAC    720
SESIMADQMA GQWYARACGM EPVVEEGKAR SALATVLDYN VMRVKGGAVG AVNGMRPDGA    780
VDASSGQSKE VWPGVTYAVA AAMVHEGMHE AAFRTAKGAH DAGWGKDGFG YAFQTPEAWT    840
EDGGYRSLHY MRPLGIWAMQ WALSPPELHK DLRAPGARSV EEESSPADAA LGQAQFEKVA    900
NMLRLPEEKQ PKGYLWAIYK VIRQMVLPE*                                     960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB11.0e-6538718197+
COG4354COG43545.0e-2861428376+
pfam12215GBA2_N2.0e-5666366309+
COG4354COG43542.0e-71495863388+
pfam04685DUF6082.0e-155498861368+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99037.101392621956hypothetical protein [Arabidopsis thaliana]
GenBankEEE67921.1019281918hypothetical protein OsJ_25789 [Oryza sativa Japonica Group]
RefSeqNP_001060825.1019281927Os08g0111200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002325943.105292723890predicted protein [Populus trichocarpa]
RefSeqXP_002444904.1019291929hypothetical protein SORBIDRAFT_07g001140 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE0245112895628500
DR8068182895628500
EC9041982795728500
FL8555322755768500
EE1713212525998500
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)