y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb07g022980.1
FamilyGT10
Protein PropertiesLength: 459 Molecular Weight: 51295.7 Isoelectric Point: 5.9435
ChromosomeChromosome/Scaffold: 7 Start: 57821297 End: 57828384
Descriptionfucosyltransferase 11
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101103350
  ILRSMESSQYYSENNIDVARGRGYKIVMTTSLSSDVPVGYFSWAEYDIMAPVPPKTEEALAAAFISNCGARNFRLQALEMLENLDVKIDSYGSCHRNRDG
  KVDKVDTLKRYRFSLAFENSNEEDYVTEKFFQSLVAGSIPVVVGAPNIQEFSPGEGAILHIKELDDVASVAKTMKNIASNPDAFNQSLRWKYDGPSDSFK
  ALIDMAAVHSSCRLCIHIATKIQLKE
Full Sequence
Protein Sequence     Length: 459     Download
MAKNAEAVES WTTSFYRRSG HWGDAVGGGA TPRAGGDGDG EDEEIRRCEQ RLEREDDVPY    60
DRDFDRDPVL VGGAAKDWNK CYVGCEFGFS ASKTPDATFG IAPDPSVDGI LRSMESSQYY    120
SENNIDVARG RGYKIVMTTS LSSDVPVGYF SWAEYDIMAP VPPKTEEALA AAFISNCGAR    180
NFRLQALEML ENLDVKIDSY GSCHRNRDGK VDKVDTLKRY RFSLAFENSN EEDYVTEKFF    240
QSLVAGSIPV VVGAPNIQEF SPGEGAILHI KELDDVASVA KTMKNIASNP DAFNQSLRWK    300
YDGPSDSFKA LIDMAAVHSS CRLCIHIATK IQLKEEMTPK FTNRPCSCSS KKGTVYHLFI    360
RERGRFKSES IYMRSGRLTL GALESAVLSK FRSLNHVPVW KDERPPSIRG GDDLKVYRIY    420
PVGLTQRQAL YGFRFRDDSE LEQYIKDHPC AKLEVIFV*                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_109.0e-29137328201+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE46961.1014585472glycoprotein 3-alpha-L-fucosyltransferase [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001062020.10145846513Os08g0472600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105840.101458645163-alpha-L-fucosyltransferase [Zea mays]
RefSeqNP_001105927.10145843498core alpha 1,3-fucosyltransferase [Zea mays]
RefSeqXP_002444504.1014581458hypothetical protein SORBIDRAFT_07g022980 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.0004212283224297A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB2nzy_B0.0004212283224297A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB2nzy_A0.0004212283224297A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB2nzx_C0.0004212283224297A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB2nzx_B0.0004212283224297A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG866488284793620
DV5329572631964580
CB6696852791814590
ES3058372741304030
CJ5576082761844590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny