y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb07g027200.1
FamilyGH13
Protein PropertiesLength: 785 Molecular Weight: 88238.5 Isoelectric Point: 6.318
ChromosomeChromosome/Scaffold: 7 Start: 62322369 End: 62328870
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132476250
  DSSNAKHPGTYIGAVSKLDHLKELGVNCIELMPCHEFNELEYFSSSSKMNFWGYSTINFFSPMARYSSSGIRDSGRGAINEFKTFVREAHKRGIEVIMDV
  VFNHTAEGNEKGPILSFRGIDNSTYYMLAPKGEFYNYSGCGNTFNCNHPVVREFIVDCLRYWVTEMHVDGFRFDLASIMTRGCSLWDPVNVYGSPMEGDM
  ITTGTLLVSPPLVDMISNDQFSWRCQGGLYQVGQFPHWNVWSEWNGKYRDTVRQFIKGTDGFAGAFAECLCGSPQLYQAGGRKPWHSVNFVCAHDGFTLA
  DLVTYNNKYNLSNGENNRDGENHNLSWNCGEEGEFASLSVRRLRKRQMRNFFVCLMVSQGVPMFYMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 785     Download
MTQLPSVSSP RPLLAVPAVR WRAGVRARPN AAGSAGAGRG RLFFRAAAAR PVATAVQAEQ    60
EDGEEEEEVV VEERYALGGA CRVLAGMPAP LGATALHGGV NFAVYSSGAS AASLCLFTPD    120
DLKAETVTEE VPLDPLLNLT GNVWHVFIHG DQLHDMLYGY RFDGVFAPER GQYYDVSNIV    180
VDPYAKAVVS RGKYGVPGPG DNCWPQMAGM IPLPHSTFNW QGDLPLKYHQ KDLVIYEMHL    240
RGFTKHDSSN AKHPGTYIGA VSKLDHLKEL GVNCIELMPC HEFNELEYFS SSSKMNFWGY    300
STINFFSPMA RYSSSGIRDS GRGAINEFKT FVREAHKRGI EVIMDVVFNH TAEGNEKGPI    360
LSFRGIDNST YYMLAPKGEF YNYSGCGNTF NCNHPVVREF IVDCLRYWVT EMHVDGFRFD    420
LASIMTRGCS LWDPVNVYGS PMEGDMITTG TLLVSPPLVD MISNDQFSWR CQGGLYQVGQ    480
FPHWNVWSEW NGKYRDTVRQ FIKGTDGFAG AFAECLCGSP QLYQAGGRKP WHSVNFVCAH    540
DGFTLADLVT YNNKYNLSNG ENNRDGENHN LSWNCGEEGE FASLSVRRLR KRQMRNFFVC    600
LMVSQGVPMF YMGDEYGHTK GGNNNTYCHD HYVNYFRWDK KEEQSSDLYR FCRLMTKFRK    660
ECESLGLEDF PTSERLQWHG HQPGKPDWSE ASRFVAFTMK DETKGEIYVA FNTSHLPVVV    720
GLPERPGFRW EPVVDTGKEA PYDFLTDGLP DRAVTIYQFS HFLNSNLYPM LSYSSIILVL    780
RPDV*                                                                840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145102.0e-13282727679+
PRK03705PRK037056.0e-14283643585+
cd11326AmyAc_Glg_debranch0218661457+
COG1523PulA085758700+
TIGR02100glgX_debranch085757716+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAA91298.10378433818Su1p [Zea mays]
GenBankAAB97167.1037844789SU1 isoamylase [Zea mays]
GenBankACG43008.1037844789isoamylase [Zea mays]
EMBLCAC82925.1017841785isoamylase [Triticum aestivum]
RefSeqXP_002445873.1017841784hypothetical protein SORBIDRAFT_07g027200 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B08670715647A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2vuy_A08670715647A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2vr5_B08670715647A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2vr5_A08670715647A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2vnc_B08670715647A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352664807450
HO8002351193154330
HO800235524374790
HO4312284223667780
HO4258893114707780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)