CAZyme Information

Basic Information
SpeciesSorghum bicolor
Cazyme IDSb10g007270.1
FamilyCE10
Protein PropertiesLength: 722 Molecular Weight: 79743 Isoelectric Point: 5.8484
ChromosomeChromosome/Scaffold: 10 Start: 7062751 End: 7072010
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104516902.5e-27
  ELVEFPTSKPGQKAYAYFYPPSNPNFQGLADEKPPLLVKTHGGPTAETRAILDLNVQYWTSRGWAYVDVNYGGSTGYGREYRERLLDKWGIVDVDDCCSC
  ARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDMFKAGASLYGVGDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKV
  VPPDQARKIYNALKEKGLPVALVEYEGEQHGFRKAENIKF
Full Sequence
Protein Sequence     Length: 722     Download
MATRLASIFS PVRSPTSAPA HLLHRTLPSF SNRRAHPSQP RMSSSSAASS APPAAAAAAG    60
GEKPAVAPYG SWRSPITADV VSGADRRLGG IALAGDGRLL WIEGRPEEKG RMVIVKEEDN    120
PVDVIPQEFA ARTLAQEYGG GAFAVDKSVV VFSNYKDQRL YKQTIGIGAP PVPLTPDYGA    180
PSVSYADGVF DPHFSRYVTV MEDRRKDSLN PTTTIAAVDL SGSDVHEPKV LISGNDFYAF    240
PRIDQSKKRM AWIEWSHPNM PWDKSELWVG YFAENGDLTK RVCIAGGNPL LVESPSEPKW    300
SPKGELFFVT DRGSGFWNIY KWVEQTNEIV PVYSLDAEFT TPLWVFGISS YDFLGNSNHI    360
VFSYRQQGRS HLGVLDCDSA SVSLLDTPFS DLSDVVAADD YFYVGGASAS IPRSIAKVTL    420
NESKTKVVNF SIVWSSSPDL VQYRPFFSTP ELVEFPTSKP GQKAYAYFYP PSNPNFQGLA    480
DEKPPLLVKT HGGPTAETRA ILDLNVQYWT SRGWAYVDVN YGGSTGYGRE YRERLLDKWG    540
IVDVDDCCSC ARFLVESGKV DGQRLCITGR SAGGYTTLAS LAFRDMFKAG ASLYGVGDLT    600
LLRAETHKFE SHYMDNLVGN ERAYYERSPI NFVNQFTCPV ILFQGLEDKV VPPDQARKIY    660
NALKEKGLPV ALVEYEGEQH GFRKAENIKF TLEQMMVFFA RLVGKFEVAD DITPIKIENF    720
D* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1073COG10731.0e-6407701310+
COG1505COG15055.0e-7445681252+
COG0412COG04129.0e-10449682244+
pfam00326Peptidase_S97.0e-49502705209+
COG1506DAP24.0e-69176706540+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC80224.106172124683hypothetical protein OsI_22153 [Oryza sativa Indica Group]
RefSeqNP_001057137.106172124683Os06g0215300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001152650.106272115674acylaminoacyl-peptidase1 [Zea mays]
RefSeqXP_002284264.10567212675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438048.1017211721hypothetical protein SORBIDRAFT_10g007270 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0657093653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0657093653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0657093653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A0657093653A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B0657093653A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802165421867220
GO8785023392646020
GT0486783441344770
GO8782783242645870
GO8469023421715120
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)