| Basic Information | |
|---|---|
| Species | Sorghum bicolor |
| Cazyme ID | Sb10g021666.1 |
| Family | AA7 |
| Protein Properties | Length: 155 Molecular Weight: 16383.8 Isoelectric Point: 9.7534 |
| Chromosome | Chromosome/Scaffold: 10 Start: 47837222 End: 47837686 |
| Description | FAD-binding Berberine family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA7 | 4 | 153 | 0 |
| AEAWAGSGATLGEVYYAVAAASRVLAFPAGICPTVGVGGHLSGGGFGTLMRRYGLAADNVIDAVLVDADGRLLNRTTMGEDLFWAIRGGGGESFGVVLSW KLRLVRVPETVTVFTVRRSISQSATDLLTKWQAIASALPRDLILRVVVQN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 155 Download |
| SARAEAWAGS GATLGEVYYA VAAASRVLAF PAGICPTVGV GGHLSGGGFG TLMRRYGLAA 60 DNVIDAVLVD ADGRLLNRTT MGEDLFWAIR GGGGESFGVV LSWKLRLVRV PETVTVFTVR 120 RSISQSATDL LTKWQAIASA LPRDLILRVV VQNQH 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam01565 | FAD_binding_4 | 8.0e-6 | 6 | 77 | 72 | + FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidises the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan. | ||
| COG0277 | GlcD | 6.0e-8 | 6 | 125 | 127 | + FAD/FMN-containing dehydrogenases [Energy production and conversion] | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0016491 | oxidoreductase activity |
| GO:0050660 | flavin adenine dinucleotide binding |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAD54128.1 | 0 | 3 | 155 | 147 | 299 | putative CPRD2 [Oryza sativa Japonica Group] |
| EMBL | CAN81654.1 | 0 | 6 | 151 | 145 | 290 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_001057826.1 | 0 | 3 | 155 | 1358 | 1510 | Os06g0548100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001143977.1 | 0 | 1 | 154 | 141 | 294 | hypothetical protein LOC100276794 [Zea mays] |
| RefSeq | XP_002438538.1 | 0 | 1 | 155 | 1 | 155 | hypothetical protein SORBIDRAFT_10g021666 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3tsj_B | 0 | 6 | 152 | 121 | 267 | A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly |
| PDB | 3tsj_A | 0 | 6 | 152 | 121 | 267 | A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly |
| PDB | 3tsh_A | 0 | 6 | 152 | 121 | 267 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
| PDB | 4dns_B | 0 | 4 | 154 | 121 | 271 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
| PDB | 4dns_A | 0 | 4 | 154 | 121 | 271 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| berberine biosynthesis | RETICULINE-OXIDASE-RXN | EC-1.21.3.3 | reticuline oxidase |
| dehydroscoulerine biosynthesis | RETICULINE-OXIDASE-RXN | EC-1.21.3.3 | reticuline oxidase |
| sanguinarine and macarpine biosynthesis | RETICULINE-OXIDASE-RXN | EC-1.21.3.3 | reticuline oxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EE180774 | 155 | 1 | 155 | 0 |
| DR973343 | 155 | 1 | 155 | 0 |
| FL889032 | 155 | 1 | 155 | 0 |
| FL865799 | 155 | 1 | 155 | 0 |
| FL800486 | 155 | 1 | 155 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |