CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi003834m
FamilyAA2
Protein PropertiesLength: 198 Molecular Weight: 21000.1 Isoelectric Point: 5.2952
ChromosomeChromosome/Scaffold: 5 Start: 18475185 End: 18476009
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2591982.4e-40
  VAGNGELAAKFLRMFFHDCFVRGCDASVLLDSPTNTVEKNAPPNLSLAGFDVIDEVKAELERACPGVVSCADIVALAARDSVSFQYKRNLWEVETGRRDG
  TVSSDQEALNDIPAPTSTFDVLLSNFSSKGLGLQDLVVLS
Full Sequence
Protein Sequence     Length: 198     Download
MAKGLLTGTG LMLALLLLVF SAVGVGTASA QAAGLKKGFY KKSCPQAEDI ARKVVWGRVA    60
GNGELAAKFL RMFFHDCFVR GCDASVLLDS PTNTVEKNAP PNLSLAGFDV IDEVKAELER    120
ACPGVVSCAD IVALAARDSV SFQYKRNLWE VETGRRDGTV SSDQEALNDI PAPTSTFDVL    180
LSNFSSKGLG LQDLVVLS 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like8.0e-1349198162+
pfam00141peroxidase4.0e-5551198149+
PLN03030PLN030304.0e-5620197178+
cd00693secretory_peroxidase8.0e-8934198166+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABQ18321.10161986190putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankABQ23446.10161986190putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankEEC70680.103119833200hypothetical protein OsI_02005 [Oryza sativa Indica Group]
RefSeqNP_001043085.103419879243Os01g0378100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002516847.10131985191conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B1.99965e-42351982166A Chain A, Peanut Peroxidase
PDB1sch_A1.99965e-42351982166A Chain A, Peanut Peroxidase
PDB3hdl_A5.99994e-41351982166A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB4a5g_B7e-40351984168A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A7e-40351984168A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG400630174251980
FF362310174251980
CD889037174251980
EG401318174251980
EG392016174251980
Orthologous Group
SpeciesID
Brassica rapaBra008715
Carica papayaevm.model.supercontig_16.92evm.model.supercontig_2186.1
Citrus sinensisorange1.1g041339m
Eucalyptus grandisEucgr.L01603.1Eucgr.H03669.1Eucgr.H03668.1
Malus domesticaMDP0000572590
Mimulus guttatusmgv1a014238m
Panicum virgatumPavirv00056620mPavirv00020581mPavirv00056619mPavirv00054667mPavirv00057804m
Pavirv00055510mPavirv00021339m
Picea abiesMA_946965g0010MA_3930037g0010MA_10433598g0020MA_48212g0010MA_149004g0010
MA_142961g0010MA_7571130g0010MA_10431507g0030
Populus trichocarpaPotri.T106200.1
Ricinus communis29726.m003967
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny